BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20180 (793 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 25 0.69 L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protei... 25 0.69 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 24 1.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 24 1.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 24 1.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 24 1.2 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 22 4.9 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 25.0 bits (52), Expect = 0.69 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +2 Query: 575 FICHR*EYKIVKKNMINNFFSFDGHITYLSFRDFS 679 F C++ +Y V K+M+N+ ++ S RD S Sbjct: 259 FQCNKCDYTCVNKSMLNSHMKSHSNVYRYSCRDCS 293 >L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protein protein. Length = 69 Score = 25.0 bits (52), Expect = 0.69 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +2 Query: 575 FICHR*EYKIVKKNMINNFFSFDGHITYLSFRDFS 679 F C++ +Y V K+M+N+ ++ S RD S Sbjct: 17 FQCNKCDYTCVNKSMLNSHMKSHSNVYRYSCRDCS 51 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +2 Query: 182 LVMVLLLSQAKLSWSTMKVALNKTK 256 L++ +++ +SW T +VA+ KTK Sbjct: 1046 LILYSIINLNVVSWGTREVAVKKTK 1070 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +2 Query: 182 LVMVLLLSQAKLSWSTMKVALNKTK 256 L++ +++ +SW T +VA+ KTK Sbjct: 1046 LILYSIINLNVVSWGTREVAVKKTK 1070 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +2 Query: 182 LVMVLLLSQAKLSWSTMKVALNKTK 256 L++ +++ +SW T +VA+ KTK Sbjct: 1046 LILYSIINLNVVSWGTREVAVKKTK 1070 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +2 Query: 182 LVMVLLLSQAKLSWSTMKVALNKTK 256 L++ +++ +SW T +VA+ KTK Sbjct: 1046 LILYSIINLNVVSWGTREVAVKKTK 1070 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 294 FRLGAKEVISGWDVGVSGMKVGGKRKII 377 FR G + V +G + +S MKV + K+I Sbjct: 208 FRAGLERVQNGENQWISVMKVNKQPKVI 235 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/22 (31%), Positives = 11/22 (50%) Frame = +3 Query: 639 LMDILPICHLETSQEDCYNYMI 704 + LP+C + Q+ C N I Sbjct: 24 IFGFLPVCSSQKGQKTCLNLSI 45 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,436 Number of Sequences: 336 Number of extensions: 3695 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21480183 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -