BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20179 (762 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 5.4 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 22 7.1 AY343324-1|AAQ21381.1| 156|Apis mellifera vacuolar H+ ATP synth... 21 9.4 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 9.4 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 21 9.4 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 22.2 bits (45), Expect = 5.4 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 532 QRQATKDAGTISGLNVLRIINEPTAAAIAYG 624 Q +A K A + N II+EPT YG Sbjct: 353 QAEAEKHAAMLYQYNFNIIISEPTERISPYG 383 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +1 Query: 691 VHPYHRGWYLRGEIHRRRHPLWE 759 + PY + L E+ RR HP W+ Sbjct: 158 LQPYKK---LSVEVVRREHPFWD 177 >AY343324-1|AAQ21381.1| 156|Apis mellifera vacuolar H+ ATP synthase 16 kDa proteolipidsubunit protein. Length = 156 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +1 Query: 601 TAAAIAYGLDKKGTGERNVLIFDSAAVLRRVHP 699 +A AYG K GTG + + +++ + P Sbjct: 25 SALGAAYGTAKSGTGIAAMSVMRPELIMKSIIP 57 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = +2 Query: 419 PEEVSSMVLTKMKETAEAYLGKTVQNAVITFPRTS 523 P + M+L M+ + QN+VI F + S Sbjct: 466 PRKRCKMILESMEIERNGLIASQRQNSVIQFAKAS 500 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 78 PFCIFNQSCYLFLKQ 34 P+C N SCY LK+ Sbjct: 9 PYCRRNFSCYYSLKR 23 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 235,410 Number of Sequences: 438 Number of extensions: 5591 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -