BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20178 (741 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0941 - 20950190-20951088,20952436-20952478,20952580-209526... 28 9.0 >04_03_0941 - 20950190-20951088,20952436-20952478,20952580-20952606, 20953189-20953301,20953872-20954715,20955740-20955790, 20956026-20956126,20956205-20956244,20956360-20957124 Length = 960 Score = 27.9 bits (59), Expect = 9.0 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 630 YKIGSPPPAGSKNDVFKFRSVNNIVIAPAKTGSDNNNKNAVS 505 Y+IG G + D +S +N V PA DNN + A+S Sbjct: 308 YRIGLVKVQGLRCDARNLKSPHNAVTDPAIEDLDNNLQQAIS 349 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,059,863 Number of Sequences: 37544 Number of extensions: 256475 Number of successful extensions: 416 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 416 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -