BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20171 (585 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|S... 28 0.87 SPAC12B10.14c |ppk2||serine/threonine protein kinase Ppk2 |Schiz... 25 6.2 >SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|Schizosaccharomyces pombe|chr 1|||Manual Length = 2397 Score = 28.3 bits (60), Expect = 0.87 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +3 Query: 435 SRWCRWWRHDVE*EICRVEGW--SSR*GW 515 S W W +D C + GW SSR GW Sbjct: 888 STWTEWQTYDGNNTYCNLSGWSQSSRYGW 916 >SPAC12B10.14c |ppk2||serine/threonine protein kinase Ppk2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 665 Score = 25.4 bits (53), Expect = 6.2 Identities = 10/44 (22%), Positives = 24/44 (54%) Frame = -3 Query: 565 VVVNLSHCSLSGSRSFNQPYLEDHPSTRHISYSTSCLHQRHHRE 434 + + S C G+ +F+ PY+E + +S+ L +++++E Sbjct: 514 IYLTKSSCLKIGNYAFSSPYIERQTNRGAVSHVPDWLIEKNYKE 557 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,588,557 Number of Sequences: 5004 Number of extensions: 54576 Number of successful extensions: 155 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 155 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 252150250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -