BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20170 (625 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22818| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_22738| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 >SB_22818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +3 Query: 468 WGNE*STICKKDGGLAHAASNFKPVFPHKLLLQTNFKIIVYNY 596 WGN CKK G A KP P + L+T +K +V Y Sbjct: 101 WGNHIDKFCKKAGPGIGAIRRLKPFVPRE-SLETMYKALVQPY 142 >SB_22738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +3 Query: 468 WGNE*STICKKDGGLAHAASNFKPVFPHKLLLQTNFKIIVYNY 596 WGN CKK G A KP P + L+T +K +V Y Sbjct: 196 WGNHIDKFCKKAGPGIGAIRRLKPFVPRE-SLETMYKALVQPY 237 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,440,147 Number of Sequences: 59808 Number of extensions: 310259 Number of successful extensions: 579 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 578 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1548368000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -