BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20167 (777 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF588665-1|ABQ96851.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588664-1|ABQ96850.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588663-1|ABQ96849.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588662-1|ABQ96848.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588661-1|ABQ96847.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588660-1|ABQ96846.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588657-1|ABQ96843.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588655-1|ABQ96841.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588654-1|ABQ96840.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588653-1|ABQ96839.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588651-1|ABQ96838.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588650-1|ABQ96837.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588649-1|ABQ96836.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588647-1|ABQ96835.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588646-1|ABQ96834.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588642-1|ABQ96832.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588641-1|ABQ96831.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588640-1|ABQ96830.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588639-1|ABQ96829.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588638-1|ABQ96828.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588637-1|ABQ96827.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588636-1|ABQ96826.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588635-1|ABQ96825.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588634-1|ABQ96824.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588633-1|ABQ96823.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588632-1|ABQ96822.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588631-1|ABQ96821.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588630-1|ABQ96820.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588628-1|ABQ96818.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588627-1|ABQ96817.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588626-1|ABQ96816.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588625-1|ABQ96815.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588624-1|ABQ96814.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588623-1|ABQ96813.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588622-1|ABQ96812.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588621-1|ABQ96811.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588620-1|ABQ96810.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588618-1|ABQ96809.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588617-1|ABQ96808.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588616-1|ABQ96807.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588615-1|ABQ96806.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588614-1|ABQ96805.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588612-1|ABQ96803.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588611-1|ABQ96802.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588609-1|ABQ96800.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588608-1|ABQ96799.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588607-1|ABQ96798.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588606-1|ABQ96797.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588605-1|ABQ96796.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588604-1|ABQ96795.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588603-1|ABQ96794.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588602-1|ABQ96793.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588601-1|ABQ96792.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588600-1|ABQ96791.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588599-1|ABQ96790.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588598-1|ABQ96789.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588597-1|ABQ96788.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588596-1|ABQ96787.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588591-1|ABQ96785.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588590-1|ABQ96784.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588589-1|ABQ96783.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588588-1|ABQ96782.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588587-1|ABQ96781.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588586-1|ABQ96780.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588585-1|ABQ96779.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588584-1|ABQ96778.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588580-1|ABQ96774.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588579-1|ABQ96773.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588577-1|ABQ96772.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588576-1|ABQ96771.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588574-1|ABQ96770.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588571-1|ABQ96769.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588570-1|ABQ96768.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588569-1|ABQ96767.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588568-1|ABQ96766.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588567-1|ABQ96765.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588566-1|ABQ96764.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588565-1|ABQ96763.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588564-1|ABQ96762.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588563-1|ABQ96761.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588562-1|ABQ96760.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588561-1|ABQ96759.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588560-1|ABQ96758.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588559-1|ABQ96757.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588558-1|ABQ96756.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588557-1|ABQ96755.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588556-1|ABQ96754.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588555-1|ABQ96753.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588554-1|ABQ96752.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588553-1|ABQ96751.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588551-1|ABQ63507.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588550-1|ABQ63506.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588549-1|ABQ63505.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588548-1|ABQ63504.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588547-1|ABQ63503.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588546-1|ABQ63502.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588545-1|ABQ63501.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588544-1|ABQ63500.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588543-1|ABQ63499.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588542-1|ABQ63498.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588541-1|ABQ63497.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588540-1|ABQ63496.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588539-1|ABQ63495.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588538-1|ABQ63494.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588537-1|ABQ63493.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588536-1|ABQ63492.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588535-1|ABQ63491.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588534-1|ABQ63490.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588533-1|ABQ63489.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588532-1|ABQ63488.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588531-1|ABQ63487.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588530-1|ABQ63486.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588529-1|ABQ63485.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588528-1|ABQ63484.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588527-1|ABQ63483.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588526-1|ABQ63482.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588525-1|ABQ63481.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588524-1|ABQ63480.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588523-1|ABQ63479.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588522-1|ABQ63478.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588521-1|ABQ63477.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588520-1|ABQ63476.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588519-1|ABQ63475.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588518-1|ABQ96750.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588517-1|ABQ96749.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588516-1|ABQ96748.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588515-1|ABQ96747.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588514-1|ABQ96746.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588512-1|ABQ96745.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588509-1|ABQ96744.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588508-1|ABQ96743.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588507-1|ABQ96742.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588506-1|ABQ96741.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588505-1|ABQ96740.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588504-1|ABQ96739.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588503-1|ABQ96738.1| 169|Anopheles gambiae transposase protein. 26 1.5 EF588502-1|ABQ96737.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588501-1|ABQ96736.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588500-1|ABQ96735.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588498-1|ABQ96733.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588497-1|ABQ96732.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588496-1|ABQ96731.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588494-1|ABQ96730.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588493-1|ABQ96729.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588492-1|ABQ96728.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588491-1|ABQ96727.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588490-1|ABQ96726.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588489-1|ABQ96725.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588488-1|ABQ96724.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588487-1|ABQ96723.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588486-1|ABQ96722.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588485-1|ABQ96721.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588484-1|ABQ96720.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588483-1|ABQ96719.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588482-1|ABQ96718.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588481-1|ABQ96717.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588480-1|ABQ96716.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588479-1|ABQ96715.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588478-1|ABQ96714.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588477-1|ABQ96713.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588476-1|ABQ96712.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588475-1|ABQ96711.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588474-1|ABQ96710.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588473-1|ABQ96709.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588472-1|ABQ96708.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588471-1|ABQ96707.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588470-1|ABQ96706.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588469-1|ABQ96705.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588468-1|ABQ96704.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588467-1|ABQ96703.1| 176|Anopheles gambiae transposase protein. 26 1.5 EF588460-1|ABQ96696.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588459-1|ABQ96695.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588458-1|ABQ96694.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588457-1|ABQ96693.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588456-1|ABQ96692.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588455-1|ABQ96691.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588454-1|ABQ96690.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588453-1|ABQ96689.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588452-1|ABQ96688.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588451-1|ABQ96687.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588450-1|ABQ96686.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588449-1|ABQ96685.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588448-1|ABQ96684.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588447-1|ABQ96683.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588446-1|ABQ96682.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588445-1|ABQ96681.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588444-1|ABQ96680.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588443-1|ABQ96679.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588442-1|ABQ96678.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588441-1|ABQ96677.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588440-1|ABQ96676.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588439-1|ABQ96675.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588438-1|ABQ96674.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588437-1|ABQ96673.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588436-1|ABQ96672.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588435-1|ABQ96671.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588434-1|ABQ96670.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588433-1|ABQ96669.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588432-1|ABQ96668.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588431-1|ABQ96667.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588430-1|ABQ96666.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588429-1|ABQ96665.1| 177|Anopheles gambiae transposase protein. 26 1.5 EF588428-1|ABQ96664.1| 177|Anopheles gambiae transposase protein. 26 1.5 AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. 26 1.5 DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. 24 4.6 CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein ... 24 4.6 Z22925-1|CAA80505.1| 211|Anopheles gambiae ANG12 precursor prot... 24 6.0 DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor prot... 24 6.0 >EF588665-1|ABQ96851.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588664-1|ABQ96850.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588663-1|ABQ96849.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588662-1|ABQ96848.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588661-1|ABQ96847.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588660-1|ABQ96846.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588657-1|ABQ96843.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588655-1|ABQ96841.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588654-1|ABQ96840.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588653-1|ABQ96839.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588651-1|ABQ96838.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588650-1|ABQ96837.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588649-1|ABQ96836.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588647-1|ABQ96835.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588646-1|ABQ96834.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588642-1|ABQ96832.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588641-1|ABQ96831.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588640-1|ABQ96830.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588639-1|ABQ96829.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588638-1|ABQ96828.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588637-1|ABQ96827.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588636-1|ABQ96826.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588635-1|ABQ96825.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588634-1|ABQ96824.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588633-1|ABQ96823.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588632-1|ABQ96822.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588631-1|ABQ96821.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588630-1|ABQ96820.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588628-1|ABQ96818.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588627-1|ABQ96817.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588626-1|ABQ96816.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588625-1|ABQ96815.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588624-1|ABQ96814.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588623-1|ABQ96813.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588622-1|ABQ96812.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588621-1|ABQ96811.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588620-1|ABQ96810.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588618-1|ABQ96809.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588617-1|ABQ96808.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588616-1|ABQ96807.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588615-1|ABQ96806.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588614-1|ABQ96805.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588612-1|ABQ96803.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588611-1|ABQ96802.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588609-1|ABQ96800.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588608-1|ABQ96799.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588607-1|ABQ96798.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588606-1|ABQ96797.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588605-1|ABQ96796.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588604-1|ABQ96795.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588603-1|ABQ96794.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588602-1|ABQ96793.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588601-1|ABQ96792.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588600-1|ABQ96791.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588599-1|ABQ96790.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588598-1|ABQ96789.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588597-1|ABQ96788.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588596-1|ABQ96787.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588591-1|ABQ96785.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588590-1|ABQ96784.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588589-1|ABQ96783.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588588-1|ABQ96782.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588587-1|ABQ96781.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588586-1|ABQ96780.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588585-1|ABQ96779.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588584-1|ABQ96778.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588580-1|ABQ96774.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588579-1|ABQ96773.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588577-1|ABQ96772.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588576-1|ABQ96771.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588574-1|ABQ96770.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588571-1|ABQ96769.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588570-1|ABQ96768.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588569-1|ABQ96767.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588568-1|ABQ96766.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588567-1|ABQ96765.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588566-1|ABQ96764.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588565-1|ABQ96763.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588564-1|ABQ96762.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588563-1|ABQ96761.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588562-1|ABQ96760.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588561-1|ABQ96759.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588560-1|ABQ96758.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588559-1|ABQ96757.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588558-1|ABQ96756.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588557-1|ABQ96755.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588556-1|ABQ96754.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588555-1|ABQ96753.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588554-1|ABQ96752.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588553-1|ABQ96751.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588551-1|ABQ63507.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588550-1|ABQ63506.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588549-1|ABQ63505.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588548-1|ABQ63504.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588547-1|ABQ63503.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588546-1|ABQ63502.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588545-1|ABQ63501.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588544-1|ABQ63500.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588543-1|ABQ63499.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588542-1|ABQ63498.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588541-1|ABQ63497.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588540-1|ABQ63496.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588539-1|ABQ63495.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588538-1|ABQ63494.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588537-1|ABQ63493.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588536-1|ABQ63492.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588535-1|ABQ63491.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588534-1|ABQ63490.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588533-1|ABQ63489.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588532-1|ABQ63488.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588531-1|ABQ63487.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588530-1|ABQ63486.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588529-1|ABQ63485.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588528-1|ABQ63484.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588527-1|ABQ63483.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588526-1|ABQ63482.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588525-1|ABQ63481.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588524-1|ABQ63480.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588523-1|ABQ63479.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588522-1|ABQ63478.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588521-1|ABQ63477.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588520-1|ABQ63476.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588519-1|ABQ63475.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588518-1|ABQ96750.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588517-1|ABQ96749.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588516-1|ABQ96748.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588515-1|ABQ96747.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588514-1|ABQ96746.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588512-1|ABQ96745.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588509-1|ABQ96744.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588508-1|ABQ96743.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588507-1|ABQ96742.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588506-1|ABQ96741.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588505-1|ABQ96740.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588504-1|ABQ96739.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588503-1|ABQ96738.1| 169|Anopheles gambiae transposase protein. Length = 169 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588502-1|ABQ96737.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588501-1|ABQ96736.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588500-1|ABQ96735.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588498-1|ABQ96733.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588497-1|ABQ96732.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588496-1|ABQ96731.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588494-1|ABQ96730.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588493-1|ABQ96729.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588492-1|ABQ96728.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588491-1|ABQ96727.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588490-1|ABQ96726.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588489-1|ABQ96725.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588488-1|ABQ96724.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588487-1|ABQ96723.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588486-1|ABQ96722.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588485-1|ABQ96721.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588484-1|ABQ96720.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588483-1|ABQ96719.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588482-1|ABQ96718.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588481-1|ABQ96717.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588480-1|ABQ96716.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588479-1|ABQ96715.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588478-1|ABQ96714.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588477-1|ABQ96713.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588476-1|ABQ96712.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588475-1|ABQ96711.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588474-1|ABQ96710.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588473-1|ABQ96709.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588472-1|ABQ96708.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588471-1|ABQ96707.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588470-1|ABQ96706.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588469-1|ABQ96705.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588468-1|ABQ96704.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588467-1|ABQ96703.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 53 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 81 >EF588460-1|ABQ96696.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588459-1|ABQ96695.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588458-1|ABQ96694.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588457-1|ABQ96693.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588456-1|ABQ96692.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588455-1|ABQ96691.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588454-1|ABQ96690.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588453-1|ABQ96689.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588452-1|ABQ96688.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588451-1|ABQ96687.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588450-1|ABQ96686.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588449-1|ABQ96685.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588448-1|ABQ96684.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588447-1|ABQ96683.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588446-1|ABQ96682.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588445-1|ABQ96681.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588444-1|ABQ96680.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588443-1|ABQ96679.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588442-1|ABQ96678.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588441-1|ABQ96677.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588440-1|ABQ96676.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588439-1|ABQ96675.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588438-1|ABQ96674.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588437-1|ABQ96673.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588436-1|ABQ96672.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588435-1|ABQ96671.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588434-1|ABQ96670.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588433-1|ABQ96669.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588432-1|ABQ96668.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588431-1|ABQ96667.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588430-1|ABQ96666.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588429-1|ABQ96665.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >EF588428-1|ABQ96664.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. Length = 603 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 23 PSTELPKPITSETPIDEIAGPEESNFPPS 109 P + +PI ID+ AGP NF PS Sbjct: 54 PYLKQKQPIPQTINIDDEAGPSAVNFQPS 82 >DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. Length = 511 Score = 24.2 bits (50), Expect = 4.6 Identities = 12/44 (27%), Positives = 17/44 (38%) Frame = +2 Query: 17 ESPSTELPKPITSETPIDEIAGPEESNFPPSASSGYGGEPDYVE 148 + P T L + E I+E GP+ N S D V+ Sbjct: 88 DEPKTSLDPVVVEEEIIEESNGPDGDNLVLEQGSNNSNSKDIVD 131 >CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein protein. Length = 196 Score = 24.2 bits (50), Expect = 4.6 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +3 Query: 375 QCNHHDYNNNNHITSSFPYPPI*GRSSKKRMSNKRT 482 Q NNNN T F YP K+ + RT Sbjct: 27 QTKQDSSNNNNRTTELFAYPAEQSAIESKQNARNRT 62 >Z22925-1|CAA80505.1| 211|Anopheles gambiae ANG12 precursor protein. Length = 211 Score = 23.8 bits (49), Expect = 6.0 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 15 VNHLPLNCLNR*PAKHLLTKSQVQKKVISLQ 107 V LPLN L ++LLT +VQ+ ++ LQ Sbjct: 34 VGLLPLNDLLDLAMRYLLTDKEVQQTLLYLQ 64 >DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor protein. Length = 344 Score = 23.8 bits (49), Expect = 6.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -2 Query: 161 MLGLLQHSLALRHNRSRHLEGNYFLLDL 78 ++G + + + NRS H NY+L L Sbjct: 60 VVGNISTCIVIARNRSMHTATNYYLFSL 87 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 863,409 Number of Sequences: 2352 Number of extensions: 18983 Number of successful extensions: 281 Number of sequences better than 10.0: 208 Number of HSP's better than 10.0 without gapping: 280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 281 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -