BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20163 (493 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24372| Best HMM Match : Ribosomal_L24e (HMM E-Value=8.5e-40) 108 3e-24 SB_35727| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.1e-07) 72 2e-13 SB_44699| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) 69 2e-12 SB_32312| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) 69 2e-12 SB_5679| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) 69 2e-12 SB_6626| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) 69 2e-12 SB_41736| Best HMM Match : Ribosomal_L24e (HMM E-Value=3.2e-07) 67 8e-12 SB_49067| Best HMM Match : Ribosomal_L24e (HMM E-Value=8.8e-07) 66 1e-11 SB_12479| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_14467| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 >SB_24372| Best HMM Match : Ribosomal_L24e (HMM E-Value=8.5e-40) Length = 154 Score = 108 bits (259), Expect = 3e-24 Identities = 47/62 (75%), Positives = 51/62 (82%) Frame = +2 Query: 14 LCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQE 193 LC YSGYKIYPGHGK V+ DGK F FLN +CE A LMRRNPR+VTWTVLYRRK KKG + Sbjct: 5 LCNYSGYKIYPGHGKRYVRQDGKVFNFLNKRCERALLMRRNPREVTWTVLYRRKHKKGTQ 64 Query: 194 EE 199 EE Sbjct: 65 EE 66 Score = 29.1 bits (62), Expect = 2.1 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 178 QKGPRGRTSKETY*KDPKVPTCDCWCSLSDIMAKRNMKPEV 300 +KG + SK+ ++ K SL +I+AKRN KPEV Sbjct: 60 KKGTQEEVSKKRTRRNIKFQRSVQGASLDNILAKRNQKPEV 100 >SB_35727| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.1e-07) Length = 139 Score = 72.1 bits (169), Expect = 2e-13 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = +2 Query: 68 KVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEE 199 K GK F +LN +CE A LMRRNPR+VTWTVLYRRK KKG +EE Sbjct: 38 KFQGKVFNYLNKRCERALLMRRNPREVTWTVLYRRKHKKGTQEE 81 Score = 29.1 bits (62), Expect = 2.1 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 178 QKGPRGRTSKETY*KDPKVPTCDCWCSLSDIMAKRNMKPEV 300 +KG + SK+ ++ K SL +I+AKRN KPEV Sbjct: 75 KKGTQEEVSKKRTRRNIKFQRSVQGASLDNILAKRNQKPEV 115 >SB_44699| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) Length = 113 Score = 69.3 bits (162), Expect = 2e-12 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 80 KTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEE 199 K F FLN +CE A LMRRNPR+VTWTVLYRRK KKG +EE Sbjct: 7 KVFNFLNKRCERALLMRRNPREVTWTVLYRRKHKKGTQEE 46 Score = 29.1 bits (62), Expect = 2.1 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 178 QKGPRGRTSKETY*KDPKVPTCDCWCSLSDIMAKRNMKPEV 300 +KG + SK+ ++ K SL +I+AKRN KPEV Sbjct: 40 KKGTQEEVSKKRTRRNIKFQRSVQGASLDNILAKRNQKPEV 80 >SB_32312| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) Length = 90 Score = 69.3 bits (162), Expect = 2e-12 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 80 KTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEE 199 K F FLN +CE A LMRRNPR+VTWTVLYRRK KKG +EE Sbjct: 7 KVFNFLNKRCERALLMRRNPREVTWTVLYRRKHKKGTQEE 46 Score = 29.1 bits (62), Expect = 2.1 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 178 QKGPRGRTSKETY*KDPKVPTCDCWCSLSDIMAKRNMKPEV 300 +KG + SK+ ++ K SL +I+AKRN KPEV Sbjct: 40 KKGTQEEVSKKRTRRNIKFQRSVQGASLDNILAKRNQKPEV 80 >SB_5679| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) Length = 90 Score = 69.3 bits (162), Expect = 2e-12 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 80 KTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEE 199 K F FLN +CE A LMRRNPR+VTWTVLYRRK KKG +EE Sbjct: 7 KVFNFLNKRCERALLMRRNPREVTWTVLYRRKHKKGTQEE 46 Score = 29.1 bits (62), Expect = 2.1 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 178 QKGPRGRTSKETY*KDPKVPTCDCWCSLSDIMAKRNMKPEV 300 +KG + SK+ ++ K SL +I+AKRN KPEV Sbjct: 40 KKGTQEEVSKKRTRRNIKFQRSVQGASLDNILAKRNQKPEV 80 >SB_6626| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) Length = 90 Score = 69.3 bits (162), Expect = 2e-12 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 80 KTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEE 199 K F FLN +CE A LMRRNPR+VTWTVLYRRK KKG +EE Sbjct: 7 KVFNFLNKRCERALLMRRNPREVTWTVLYRRKHKKGTQEE 46 Score = 29.1 bits (62), Expect = 2.1 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 178 QKGPRGRTSKETY*KDPKVPTCDCWCSLSDIMAKRNMKPEV 300 +KG + SK+ ++ K SL +I+AKRN KPEV Sbjct: 40 KKGTQEEVSKKRTRRNIKFQRSVQGASLDNILAKRNQKPEV 80 >SB_41736| Best HMM Match : Ribosomal_L24e (HMM E-Value=3.2e-07) Length = 104 Score = 66.9 bits (156), Expect = 8e-12 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +2 Query: 80 KTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEE 199 K F FLN +CE A LMRRNPR+VTWTVLYRR KKG +EE Sbjct: 7 KVFNFLNKRCERALLMRRNPREVTWTVLYRRMHKKGTQEE 46 Score = 29.1 bits (62), Expect = 2.1 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 178 QKGPRGRTSKETY*KDPKVPTCDCWCSLSDIMAKRNMKPEV 300 +KG + SK+ ++ K SL +I+AKRN KPEV Sbjct: 40 KKGTQEEVSKKRTRRNIKFQRSVQGASLDNILAKRNQKPEV 80 >SB_49067| Best HMM Match : Ribosomal_L24e (HMM E-Value=8.8e-07) Length = 90 Score = 66.1 bits (154), Expect = 1e-11 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +2 Query: 80 KTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEE 199 K F FLN +CE A LMRRNPR+VTWTVLYR K KKG +EE Sbjct: 7 KVFNFLNKRCERALLMRRNPREVTWTVLYRCKHKKGTQEE 46 Score = 29.1 bits (62), Expect = 2.1 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 178 QKGPRGRTSKETY*KDPKVPTCDCWCSLSDIMAKRNMKPEV 300 +KG + SK+ ++ K SL +I+AKRN KPEV Sbjct: 40 KKGTQEEVSKKRTRRNIKFQRSVQGASLDNILAKRNQKPEV 80 >SB_12479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 29.1 bits (62), Expect = 2.1 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 178 QKGPRGRTSKETY*KDPKVPTCDCWCSLSDIMAKRNMKPEV 300 +KG + SK+ ++ K SL +I+AKRN KPEV Sbjct: 2 KKGTQEEVSKKRTRRNIKFQRSVQGASLDNILAKRNQKPEV 42 >SB_14467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 352 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +2 Query: 125 MRRNPRKVTWTVLYRR 172 M+RNPRK+ WT +R+ Sbjct: 1 MKRNPRKMKWTKAFRK 16 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,723,171 Number of Sequences: 59808 Number of extensions: 230935 Number of successful extensions: 505 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 501 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1050596726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -