BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20163 (493 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 4.3 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 22 9.9 AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 22 9.9 AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 22 9.9 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 22 9.9 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.4 bits (48), Expect = 4.3 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 Query: 219 LVRFFACSSSWPFLNL 172 L+R F + SWP LNL Sbjct: 903 LLRVFKLAKSWPTLNL 918 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 22.2 bits (45), Expect = 9.9 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 8 SGLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCE 112 +G C Y + PG K+ K+D F F + +CE Sbjct: 116 NGSCLY----VPPGIFKSTCKIDITWFPFDDQRCE 146 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 22.2 bits (45), Expect = 9.9 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 8 SGLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCE 112 +G C Y + PG K+ K+D F F + +CE Sbjct: 148 NGSCLY----VPPGIFKSTCKIDITWFPFDDQRCE 178 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 22.2 bits (45), Expect = 9.9 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 149 LLYEDSSSSNGRLHILNSG 93 L+++DSS SNG NSG Sbjct: 391 LIHDDSSFSNGDASNRNSG 409 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 22.2 bits (45), Expect = 9.9 Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -3 Query: 305 LRTSGFILRLAIMSLS-EHQQS 243 LRTSGF L +M ++ +H Q+ Sbjct: 15 LRTSGFAFNLKVMQINVDHCQA 36 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 425,535 Number of Sequences: 2352 Number of extensions: 7237 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43554477 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -