BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20162 (596 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 3.0 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 4.0 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 4.0 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 5.3 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 21 6.9 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 21 6.9 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 21 6.9 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 21 6.9 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 21 6.9 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 21 6.9 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 21 6.9 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 21 9.2 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 21 9.2 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 21 9.2 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 21 9.2 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 9.2 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 9.2 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 9.2 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 9.2 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 21 9.2 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 21 9.2 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 21 9.2 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 21 9.2 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 21 9.2 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 21 9.2 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 21 9.2 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 21 9.2 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 21 9.2 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 21 9.2 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 21 9.2 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 9.2 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 9.2 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 9.2 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 9.2 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.6 bits (46), Expect = 3.0 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -1 Query: 521 HIRKSPSVGKRGGGVDRSLPVRLYPRGP 438 H SVG+R G R++PV P P Sbjct: 1833 HYGSRGSVGRRSVGSARNIPVSGSPEPP 1860 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.2 bits (45), Expect = 4.0 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 120 CYLNTVPFVSKTTSVDC 170 CYLNT ++ T+V C Sbjct: 564 CYLNTFLLLATPTTVTC 580 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.2 bits (45), Expect = 4.0 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 120 CYLNTVPFVSKTTSVDC 170 CYLNT ++ T+V C Sbjct: 654 CYLNTFLLLATPTTVTC 670 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 5.3 Identities = 7/28 (25%), Positives = 13/28 (46%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 + + E +P +H+ S + P N Y Sbjct: 366 ISIQEQIPRFRHIGPSTSFPRFIPPNAY 393 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/30 (26%), Positives = 13/30 (43%) Frame = +3 Query: 291 SSVLLLEMVPSVKHVCSSVTLQMLFPANIY 380 S + + E +P +H+ S P N Y Sbjct: 130 SWISIQEQIPRFRHIGPSTPFPRFIPPNAY 159 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/30 (26%), Positives = 13/30 (43%) Frame = +3 Query: 291 SSVLLLEMVPSVKHVCSSVTLQMLFPANIY 380 S + + E +P +H+ S P N Y Sbjct: 130 SWISIQEQIPRFRHIGPSTPFPRFIPPNAY 159 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/30 (26%), Positives = 13/30 (43%) Frame = +3 Query: 291 SSVLLLEMVPSVKHVCSSVTLQMLFPANIY 380 S + + E +P +H+ S P N Y Sbjct: 130 SWISIQEQIPRFRHIGPSTPFPRFIPPNAY 159 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/30 (26%), Positives = 13/30 (43%) Frame = +3 Query: 291 SSVLLLEMVPSVKHVCSSVTLQMLFPANIY 380 S + + E +P +H+ S P N Y Sbjct: 130 SWISIQEQIPRFRHIGPSTPFPRFIPPNAY 159 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/30 (26%), Positives = 13/30 (43%) Frame = +3 Query: 291 SSVLLLEMVPSVKHVCSSVTLQMLFPANIY 380 S + + E +P +H+ S P N Y Sbjct: 130 SWISIQEQIPRFRHIGPSTLFPRFIPPNAY 159 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/30 (26%), Positives = 13/30 (43%) Frame = +3 Query: 291 SSVLLLEMVPSVKHVCSSVTLQMLFPANIY 380 S + + E +P +H+ S P N Y Sbjct: 130 SWISIQEQIPRFRHIGPSTPFPRFIPPNAY 159 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/28 (28%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 V + E +P +H+ S P N Y Sbjct: 141 VPMQEQIPRFRHIGPSTPFPQFIPPNAY 168 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/28 (25%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 + + E +P +H+ S P N Y Sbjct: 143 ISIQEQIPRFRHIGPSTPFPRFIPPNAY 170 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/28 (25%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 + + E +P +H+ S P N Y Sbjct: 143 ISIQEQIPRFRHIGPSTPFPRFIPPNAY 170 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/28 (25%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 + + E +P +H+ S P N Y Sbjct: 143 ISIQEQIPRFRHIGPSTPFPRFIPPNAY 170 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/28 (25%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 + + E +P +H+ S P N Y Sbjct: 143 ISIQEQIPRFRHIGPSTPFPRFIPPNAY 170 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/28 (25%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 + + E +P +H+ S P N Y Sbjct: 135 ISIQEQIPRFRHIGPSTPFPRFIPPNAY 162 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/28 (25%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 + + E +P +H+ S P N Y Sbjct: 135 ISIQEQIPRFRHIGPSTPFPRFIPPNAY 162 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/28 (25%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 + + E +P +H+ S P N Y Sbjct: 135 ISIQEQIPRFRHIGPSTPFPRFIPPNAY 162 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/28 (25%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 + + E +P +H+ S P N Y Sbjct: 135 ISIQEQIPRFRHIGPSTPFPRFIPPNAY 162 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/28 (25%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 + + E +P +H+ S P N Y Sbjct: 141 ISIQEQIPRFRHIGPSTPFPRFIPPNAY 168 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/28 (28%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 V + E +P +H+ S P N Y Sbjct: 141 VPMQEQIPRFRHIGPSTPFPRFIPPNAY 168 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/28 (28%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 V + E +P +H+ S P N Y Sbjct: 141 VPMQEQIPRFRHIGPSTPFPRFIPPNAY 168 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/28 (28%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 V + E +P +H+ S P N Y Sbjct: 141 VPMQEQIPRFRHIGPSTPFPRFIPPNAY 168 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/28 (28%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 V + E +P +H+ S P N Y Sbjct: 141 VPMQEQIPRFRHIGPSTPFPRFIPPNAY 168 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/28 (28%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 V + E +P +H+ S P N Y Sbjct: 141 VPMQEQIPRFRHIGPSTPFPRFIPPNAY 168 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/28 (28%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 V + E +P +H+ S P N Y Sbjct: 141 VPMQEQIPRFRHIGPSTPFPRFIPPNAY 168 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/28 (25%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 + + E +P +H+ S P N Y Sbjct: 138 ISIQEQIPRFRHIGPSTPFPRFIPPNAY 165 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/28 (25%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 + + E +P +H+ S P N Y Sbjct: 138 ISIQEQIPRFRHIGPSTPFPRFIPPNAY 165 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/28 (25%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 + + E +P +H+ S P N Y Sbjct: 138 ISIQEQIPRFRHIGPSTPFPRFIPPNAY 165 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/28 (25%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 + + E +P +H+ S P N Y Sbjct: 138 ISIQEQIPRFRHIGPSTPFPRFIPPNAY 165 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/28 (28%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 V + E +P +H+ S P N Y Sbjct: 144 VPMQEQIPRFRHIGPSTPFPRFIPPNAY 171 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/28 (25%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 + + E +P +H+ S P N Y Sbjct: 383 ISMQEQIPRFRHIGPSTPFPRFIPPNAY 410 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/28 (25%), Positives = 12/28 (42%) Frame = +3 Query: 297 VLLLEMVPSVKHVCSSVTLQMLFPANIY 380 + + E +P +H+ S P N Y Sbjct: 368 ISIQEQIPRFRHIGPSTPFPRFIPPNAY 395 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 129 NTVPFVSKTTSVDCDADV 182 N + + +T S DCD DV Sbjct: 119 NLLEDIYETLSYDCDVDV 136 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,134 Number of Sequences: 438 Number of extensions: 3684 Number of successful extensions: 36 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -