BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20160 (544 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochr... 22 3.0 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 5.3 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 21 9.2 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 9.2 >AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 125 Score = 22.2 bits (45), Expect = 3.0 Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Frame = +1 Query: 127 KRANQLKFRVLCINFLIKMIPLVLFV---LGAILATTEG 234 K +LK+ CI ++++ P V F+ LG + T G Sbjct: 39 KSLQELKYMERCIKEVLRLYPSVPFIARSLGEDIVTYSG 77 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 5.3 Identities = 7/29 (24%), Positives = 18/29 (62%) Frame = +1 Query: 403 LLLNAGPINVYPLTTALPNVIWADSLLDR 489 +L+N + ++ T+A +W +S+++R Sbjct: 434 ILINVPSLIIHVSTSAYVATVWINSVINR 462 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 20.6 bits (41), Expect = 9.2 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 506 TLVHQLNHPTLRL 544 TLVHQLN L L Sbjct: 507 TLVHQLNTEVLHL 519 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 20.6 bits (41), Expect = 9.2 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +1 Query: 142 LKFRVLCINFLIKMIPLVLFVLGAILATTE 231 L + ++F + +IP +F+L IL E Sbjct: 290 LMLGTVVLSFFLCLIPFRVFILWIILVPEE 319 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,471 Number of Sequences: 336 Number of extensions: 2726 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13306679 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -