BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20158 (529 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 35 0.029 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 35 0.039 At5g38560.1 68418.m04662 protein kinase family protein contains ... 31 0.36 At5g01280.1 68418.m00037 expressed protein 31 0.48 At3g13220.1 68416.m01654 ABC transporter family protein contains... 31 0.48 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 30 0.84 At3g02540.2 68416.m00243 ubiquitin family protein contains Pfam ... 30 0.84 At3g02540.1 68416.m00242 ubiquitin family protein contains Pfam ... 30 0.84 At3g10070.1 68416.m01207 transcription initiation factor IID (TF... 30 1.1 At2g37360.1 68415.m04582 ABC transporter family protein 30 1.1 At2g26920.1 68415.m03229 ubiquitin-associated (UBA)/TS-N domain-... 30 1.1 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 30 1.1 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 30 1.1 At1g70640.1 68414.m08143 octicosapeptide/Phox/Bem1p (PB1) domain... 29 1.5 At3g53510.1 68416.m05908 ABC transporter family protein breast c... 29 1.9 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 29 2.6 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 29 2.6 At3g09000.1 68416.m01053 proline-rich family protein 29 2.6 At2g23990.2 68415.m02866 plastocyanin-like domain-containing pro... 29 2.6 At2g23990.1 68415.m02865 plastocyanin-like domain-containing pro... 29 2.6 At3g24550.1 68416.m03083 protein kinase family protein contains ... 28 3.4 At2g44790.1 68415.m05574 uclacyanin II strong similarity to ucla... 28 3.4 At1g36150.1 68414.m04494 protease inhibitor/seed storage/lipid t... 28 3.4 At1g22870.1 68414.m02855 protein kinase family protein contains ... 28 3.4 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 28 3.4 At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 28 4.5 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 28 4.5 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 28 4.5 At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid t... 28 4.5 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 28 4.5 At2g13610.1 68415.m01500 ABC transporter family protein 28 4.5 At4g34440.1 68417.m04894 protein kinase family protein contains ... 27 5.9 At4g27420.1 68417.m03941 ABC transporter family protein D.melano... 27 5.9 At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identic... 27 5.9 At3g18810.1 68416.m02389 protein kinase family protein contains ... 27 5.9 At2g01320.4 68415.m00049 ABC transporter family protein 27 5.9 At2g01320.3 68415.m00047 ABC transporter family protein 27 5.9 At2g01320.2 68415.m00046 ABC transporter family protein 27 5.9 At2g01320.1 68415.m00048 ABC transporter family protein 27 5.9 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 27 7.8 At4g28300.2 68417.m04053 hydroxyproline-rich glycoprotein family... 27 7.8 At4g28300.1 68417.m04052 hydroxyproline-rich glycoprotein family... 27 7.8 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 27 7.8 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 27 7.8 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 27 7.8 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 27 7.8 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 35.1 bits (77), Expect = 0.029 Identities = 21/51 (41%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = +3 Query: 48 PTCPTSATGSRAPRWP--PTPSTGPSCSATRPTVISSIPRPPSRTWTWKTP 194 P PT + S P P P PS P S PT S+P PP T T TP Sbjct: 155 PPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTP 205 Score = 28.7 bits (61), Expect = 2.6 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = +3 Query: 45 SPTCPTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRPPSRTWTWKTP 194 +P+ P+ + P P PS P + T PT S+P PP T T TP Sbjct: 189 TPSVPSPPDVTPTPPTPSVPSP-PDVTPTPPT--PSVPSPPDVTPTPPTP 235 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 34.7 bits (76), Expect = 0.039 Identities = 21/51 (41%), Positives = 24/51 (47%) Frame = +3 Query: 15 STRSRCTCAGSPTCPTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRPP 167 S S T GSP P+S T S PPTPST P+ + IP PP Sbjct: 535 SPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPP 585 Score = 31.1 bits (67), Expect = 0.48 Identities = 19/44 (43%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = +3 Query: 48 PTCPTSAT-GSRAPRWP--PTPSTGPSCSATRPTVISSIPRPPS 170 PT PT+ T G P P PTP P S T PT S P P+ Sbjct: 469 PTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPT 512 Score = 31.1 bits (67), Expect = 0.48 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 4/50 (8%) Frame = +3 Query: 33 TCAGSP-TCPTSAT-GSRAPRWPPTPSTG--PSCSATRPTVISSIPRPPS 170 T GSP + PT+ T G P P TPS G P + P+ ++P PPS Sbjct: 489 TPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPS 538 Score = 30.7 bits (66), Expect = 0.63 Identities = 23/63 (36%), Positives = 30/63 (47%), Gaps = 7/63 (11%) Frame = +3 Query: 9 GRSTRSRCTCAGSPTCPTSA----TGSRAPRWP---PTPSTGPSCSATRPTVISSIPRPP 167 GRSTR PT P+ + S +P P P+P T PS + P+ S +P PP Sbjct: 401 GRSTRPPVVVPSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSP-SIVPSPP 459 Query: 168 SRT 176 S T Sbjct: 460 STT 462 Score = 28.7 bits (61), Expect = 2.6 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +3 Query: 45 SPTCPTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRP 164 SPT PT + PTP P S T P+ S P P Sbjct: 484 SPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSP 523 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 31.5 bits (68), Expect = 0.36 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 45 SPTCPTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRP 164 SP+ PT T + P P T ++ PS + T P+ ++ P P Sbjct: 159 SPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLAPPPTP 198 Score = 27.9 bits (59), Expect = 4.5 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +3 Query: 57 PTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRPP 167 P T P PP + PS + P V+SS P PP Sbjct: 23 PPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPP 59 >At5g01280.1 68418.m00037 expressed protein Length = 460 Score = 31.1 bits (67), Expect = 0.48 Identities = 18/59 (30%), Positives = 29/59 (49%) Frame = +3 Query: 6 RGRSTRSRCTCAGSPTCPTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRPPSRTWT 182 R S+ S P PT + + A R P TP++ + + TR T+ SS +R+W+ Sbjct: 83 RRPSSSSSSRSTSRPPTPTRKSKTPAKR-PSTPTSRATSTTTRATLTSSSTTSSTRSWS 140 >At3g13220.1 68416.m01654 ABC transporter family protein contains Pfam profile: PF00005 ABC transporter; similar to white protein GB:Q27256 [Anopheles gambiae] Length = 685 Score = 31.1 bits (67), Expect = 0.48 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 23 IPVYLRWITYLSYIRYGFEGTALATYS 103 IP +++W+ YLS++ YGF YS Sbjct: 598 IPKFMQWLKYLSFMHYGFRLLLKVQYS 624 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 30.3 bits (65), Expect = 0.84 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = +3 Query: 57 PTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRPPS 170 P+ +T S P P TPS+ PS P+ SS P PPS Sbjct: 123 PSPSTPSSPPSTPSTPSSPPST----PSTPSSPPSPPS 156 >At3g02540.2 68416.m00243 ubiquitin family protein contains Pfam profiles PF00240: Ubiquitin family, PF00627: UBA/TS-N domain; Length = 299 Score = 30.3 bits (65), Expect = 0.84 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = +3 Query: 45 SPTCPTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRPPSRTWTWKTP 194 S + P + +R P PP P+ P+ A TV + IP P T + TP Sbjct: 113 SVSAPVAPAPTRPP--PPAPTPTPAPVAATETVTTPIPEPVPATISSSTP 160 >At3g02540.1 68416.m00242 ubiquitin family protein contains Pfam profiles PF00240: Ubiquitin family, PF00627: UBA/TS-N domain; Length = 419 Score = 30.3 bits (65), Expect = 0.84 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = +3 Query: 45 SPTCPTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRPPSRTWTWKTP 194 S + P + +R P PP P+ P+ A TV + IP P T + TP Sbjct: 113 SVSAPVAPAPTRPP--PPAPTPTPAPVAATETVTTPIPEPVPATISSSTP 160 >At3g10070.1 68416.m01207 transcription initiation factor IID (TFIID) subunit A family protein similar to hypothetical protein GB:CAB10099 [Schizosaccharomyces pombe]; contains Pfam profile PF03847: Transcription initiation factor TFIID subunit A Length = 539 Score = 29.9 bits (64), Expect = 1.1 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +3 Query: 45 SPTCPTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRPPS 170 +P P+ + S + PTPST PS S +V+SSIP P+ Sbjct: 16 TPPQPSDSKPSTLTQIQPTPSTNPSPS----SVVSSIPSSPA 53 >At2g37360.1 68415.m04582 ABC transporter family protein Length = 755 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 11 SFNAIPVYLRWITYLSYIRYGFEG 82 S + IPVY W Y+S ++Y +EG Sbjct: 630 SRDRIPVYWLWFHYISLVKYPYEG 653 >At2g26920.1 68415.m03229 ubiquitin-associated (UBA)/TS-N domain-containing protein contains Pfam profile PF00627: UBA/TS-N domain Length = 646 Score = 29.9 bits (64), Expect = 1.1 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +3 Query: 57 PTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRPPSR 173 P + RWPPT PS S + P+ S P+P R Sbjct: 344 PQQSAALADKRWPPTTGQVPSASYSLPSSPSPSPQPAVR 382 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = +3 Query: 45 SPTCPTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRPPS 170 SP P+S +PP P P + P I S P PPS Sbjct: 512 SPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPS 553 >At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identical to gi_3883128_gb_AAC77827 Length = 133 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +3 Query: 33 TCAGSPTCPTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRPPSRT 176 T + P PT + RA P+PS P SA PT + +PP+ + Sbjct: 29 TISPLPATPTPSQSPRATAPAPSPSANPPPSA--PTTAPPVSQPPTES 74 >At1g70640.1 68414.m08143 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 174 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 12 RSTRSRCTCAGSPTCPTSATGSRAPRWPPTPSTGPSC 122 +STR+ + P+ +S++ R PP+PST +C Sbjct: 109 KSTRTTANSSPPPSTTSSSSSKSRSRSPPSPSTPETC 145 >At3g53510.1 68416.m05908 ABC transporter family protein breast cancer resistance protein (BCRP), Homo sapiens, EMBL:AF098951 Length = 739 Score = 29.1 bits (62), Expect = 1.9 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 11 SFNAIPVYLRWITYLSYIRYGFEG 82 S + IP+Y W YLS ++Y +EG Sbjct: 614 SRDRIPLYWIWFHYLSLVKYPYEG 637 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 28.7 bits (61), Expect = 2.6 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +3 Query: 48 PTCPTSATGSRAPRWPPTP--STGPSCSATRPTVISSIPRPPSRTWTWKTP 194 PT PT A PP P ST P AT P + P PP + TP Sbjct: 54 PTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTP 104 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 28.7 bits (61), Expect = 2.6 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +3 Query: 93 PPTPSTGPSCSATRPTVISSIPRPPSRTWTWKTP 194 PPTP P+ + T P V P PP T TP Sbjct: 159 PPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTP 192 >At3g09000.1 68416.m01053 proline-rich family protein Length = 541 Score = 28.7 bits (61), Expect = 2.6 Identities = 19/53 (35%), Positives = 29/53 (54%) Frame = +3 Query: 15 STRSRCTCAGSPTCPTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRPPSR 173 S RS +P P+SA+ + P TP+ PS + T P+++SS + PSR Sbjct: 216 SARSATPTRSNPR-PSSASSKKPVSRPATPTRRPS-TPTGPSIVSS--KAPSR 264 >At2g23990.2 68415.m02866 plastocyanin-like domain-containing protein Length = 226 Score = 28.7 bits (61), Expect = 2.6 Identities = 17/46 (36%), Positives = 19/46 (41%) Frame = +3 Query: 45 SPTCPTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRPPSRTWT 182 SP P + P PP PST P+ A P P P S T T Sbjct: 149 SPNHPKPGPAAVTPTLPPKPSTTPAAPAPAPPT----PSPKSSTST 190 >At2g23990.1 68415.m02865 plastocyanin-like domain-containing protein Length = 207 Score = 28.7 bits (61), Expect = 2.6 Identities = 17/46 (36%), Positives = 19/46 (41%) Frame = +3 Query: 45 SPTCPTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRPPSRTWT 182 SP P + P PP PST P+ A P P P S T T Sbjct: 130 SPNHPKPGPAAVTPTLPPKPSTTPAAPAPAPPT----PSPKSSTST 171 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 28.3 bits (60), Expect = 3.4 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = +3 Query: 45 SPTCPTSATGSRAPRWPPTPSTGP---SCSATRPTVISSIPRPPS 170 SP PT+ + PR PP+P+ GP +T T ++ P PPS Sbjct: 89 SPPSPTTPSN---PRSPPSPNQGPPNTPSGSTPRTPSNTKPSPPS 130 >At2g44790.1 68415.m05574 uclacyanin II strong similarity to uclacyanin II GI:3399769 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin II GI:3399768 Length = 202 Score = 28.3 bits (60), Expect = 3.4 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +3 Query: 45 SPTCPTSATGSRAPRWPPTPSTGPSCSATRPT--VISSIPRPPSR 173 +PT P+S G+ P P +P +G S + T PT S+ P PP + Sbjct: 134 TPTPPSSTPGT--PTTPESPPSGGSPTPTTPTPGAGSTSPPPPPK 176 >At1g36150.1 68414.m04494 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein low similarity to glucoamylase S1/S2 [Precursor] from Saccharomyces cerevisiae [SP|P08640], proteophosphoglycan from Leishmania major [GI:5420387]; contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 256 Score = 28.3 bits (60), Expect = 3.4 Identities = 16/45 (35%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = +3 Query: 30 CTCAGSPTCPTSATGSRAPRWPP--TPSTGPSCSATRPTVISSIP 158 C P C S + P PP +P+T PS SA P + S P Sbjct: 113 CNVPIDPNCDVSTPAASTPVSPPVESPTTSPS-SAKSPAITPSSP 156 >At1g22870.1 68414.m02855 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 913 Score = 28.3 bits (60), Expect = 3.4 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +3 Query: 3 ARGRSTRSRCTCAGSPTCPTSATGSRAPRWPPTPSTGPSCS 125 A+ + +R AG+PT P+ WPP P++ + S Sbjct: 722 AQPANDETRINAAGTPTTPSFDELDPFANWPPRPNSASTAS 762 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 28.3 bits (60), Expect = 3.4 Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +3 Query: 48 PTCP-TSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRPPSRT 176 P CP T P PP P P A +P S P+PP+ T Sbjct: 66 PACPPTPPKPQPKPAPPPEPKPAPP-PAPKPVPCPSPPKPPAPT 108 >At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical to gi_11935088_gb_AAG41964 Length = 209 Score = 27.9 bits (59), Expect = 4.5 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = +3 Query: 45 SPTCPT-SATGSRAPRWPPT-PSTGPSCSATRPTVISSIPRPPSRTWTWKTPI 197 +P+ PT S T S A P T P+ P+ SA+ P P P S + TP+ Sbjct: 34 TPSAPTTSPTKSPAVTSPTTAPAKTPTASASSPVESPKSPAPVSESSPPPTPV 86 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 27.9 bits (59), Expect = 4.5 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +3 Query: 45 SPTCPTSATGSRAPRW-PPTPSTGPSCSATRPTVISSIPRPP 167 SP P + P + PP P P S + P V S PRPP Sbjct: 604 SPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPP 645 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 27.9 bits (59), Expect = 4.5 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 45 SPTCPTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRPPS 170 SP P S P PP P P S P V SS P PPS Sbjct: 486 SPPPPPPPVYSPPPP-PPPPPPPPVYSPPPPPVYSSPPPPPS 526 >At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein identical to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 168 Score = 27.9 bits (59), Expect = 4.5 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +3 Query: 30 CTCAGSPTCPTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRP--PSRT 176 C C SP + P P P PS S P+V S PRP P RT Sbjct: 28 CGCNPSPKHKPVPSPKPKPVPSPKPKPVPSPSVPSPSVPSPNPRPVTPPRT 78 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 27.9 bits (59), Expect = 4.5 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +3 Query: 45 SPTCPTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRPP 167 S P+S + S A + PP P P + R + +SS P PP Sbjct: 585 STPSPSSTSNSIATQGPPPPPPPPPLQSHR-SALSSSPLPP 624 >At2g13610.1 68415.m01500 ABC transporter family protein Length = 649 Score = 27.9 bits (59), Expect = 4.5 Identities = 24/85 (28%), Positives = 39/85 (45%) Frame = +2 Query: 11 SFNAIPVYLRWITYLSYIRYGFEGTALATYSFNRTKLQCHAPYCHFKYPQTTLEDLDMED 190 S + IP Y ++ Y+S +Y FEG + +S + L+ C E+ E+ Sbjct: 552 SNHEIPGYWIFMHYISLFKYPFEGFLINEFSKSNKCLEYGFGKCLVTEEDLLKEERYGEE 611 Query: 191 ADFALDIAALCLIFVLLRIFAFSSY 265 + + + LC FVLL + F SY Sbjct: 612 SRWRNVVIMLC--FVLL--YRFISY 632 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 27.5 bits (58), Expect = 5.9 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Frame = +3 Query: 33 TCAGSPTCPTSATGSRAPRWPPTPSTGP---SCSATRPTVISSIPRPPS 170 T G+P P++ T PPTP + P S SA P + +S PP+ Sbjct: 14 TSNGTP--PSNGTSPSNESSPPTPPSSPPPSSISAPPPDISASFSPPPA 60 >At4g27420.1 68417.m03941 ABC transporter family protein D.melanogaster P element CaSpeR-1 gene (white protein),PID:g870996 Length = 639 Score = 27.5 bits (58), Expect = 5.9 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 7/43 (16%) Frame = +2 Query: 23 IPVYLRWITYLSYIRYGFEGTALATYSFNRT-------KLQCH 130 +PV++ WI Y+S Y ++ L Y+ N KL+CH Sbjct: 551 VPVFISWIKYVSIGYYTYKLLILGQYTANELYPCGDNGKLRCH 593 >At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identical to gi|10880497|gb|AAG24278; supported by Ceres cDNA 265772 Length = 127 Score = 27.5 bits (58), Expect = 5.9 Identities = 16/51 (31%), Positives = 20/51 (39%) Frame = +3 Query: 18 TRSRCTCAGSPTCPTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRPPS 170 TRS P + T S P PTPS P+ + P S +P S Sbjct: 29 TRSPLPSPAQPPRTAAPTPSITPTPTPTPSATPTAAPVSPPAGSPLPSSAS 79 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 27.5 bits (58), Expect = 5.9 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +3 Query: 45 SPTCPTSATGSRAPRWPPTPSTGPSCSATRPTVISS--IPRPPS 170 +P P+S+ + PP+ S+ PS A P SS P+PPS Sbjct: 15 TPPSPSSSDNQQQSSPPPSDSSSPSPPAPPPPDDSSNGSPQPPS 58 >At2g01320.4 68415.m00049 ABC transporter family protein Length = 725 Score = 27.5 bits (58), Expect = 5.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 26 PVYLRWITYLSYIRYGFEGTALATYS 103 P+ RWI S IR+ F+G + +S Sbjct: 579 PIIFRWIPRASLIRWAFQGLCINEFS 604 >At2g01320.3 68415.m00047 ABC transporter family protein Length = 728 Score = 27.5 bits (58), Expect = 5.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 26 PVYLRWITYLSYIRYGFEGTALATYS 103 P+ RWI S IR+ F+G + +S Sbjct: 579 PIIFRWIPRASLIRWAFQGLCINEFS 604 >At2g01320.2 68415.m00046 ABC transporter family protein Length = 727 Score = 27.5 bits (58), Expect = 5.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 26 PVYLRWITYLSYIRYGFEGTALATYS 103 P+ RWI S IR+ F+G + +S Sbjct: 579 PIIFRWIPRASLIRWAFQGLCINEFS 604 >At2g01320.1 68415.m00048 ABC transporter family protein Length = 725 Score = 27.5 bits (58), Expect = 5.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 26 PVYLRWITYLSYIRYGFEGTALATYS 103 P+ RWI S IR+ F+G + +S Sbjct: 579 PIIFRWIPRASLIRWAFQGLCINEFS 604 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 27.1 bits (57), Expect = 7.8 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = +3 Query: 48 PTCPTSATGSRAPRW-PPTPSTGP-SCSATRPTVISSIPRPPSRTWTWKTP 194 PT + P + PPTP+ P + S +P + PP + T+K P Sbjct: 110 PTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPP 160 >At4g28300.2 68417.m04053 hydroxyproline-rich glycoprotein family protein Length = 438 Score = 27.1 bits (57), Expect = 7.8 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 6/47 (12%) Frame = +3 Query: 45 SPTCPTSATGSRAPR----WPPTPSTGPSCSATRPTVISSIP--RPP 167 +P+ P+SA P+ WPP P P S PT + P +PP Sbjct: 220 APSHPSSAQTQSFPQYQQNWPPQPQARPQSSGGYPTYSPAPPGNQPP 266 >At4g28300.1 68417.m04052 hydroxyproline-rich glycoprotein family protein Length = 496 Score = 27.1 bits (57), Expect = 7.8 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 6/47 (12%) Frame = +3 Query: 45 SPTCPTSATGSRAPR----WPPTPSTGPSCSATRPTVISSIP--RPP 167 +P+ P+SA P+ WPP P P S PT + P +PP Sbjct: 278 APSHPSSAQTQSFPQYQQNWPPQPQARPQSSGGYPTYSPAPPGNQPP 324 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 27.1 bits (57), Expect = 7.8 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +3 Query: 48 PTCPTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRPP 167 P P + P P TPST PS P + +P PP Sbjct: 80 PMAPPPMPMASPPMMPMTPSTSPS-----PLTVPDMPSPP 114 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 27.1 bits (57), Expect = 7.8 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +3 Query: 45 SPTCPTSATGSR-APRWPPTPSTGPSCSATRPTVISSIP 158 +PT P +AT + P PP +T P SA P S P Sbjct: 22 APTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPP 60 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 27.1 bits (57), Expect = 7.8 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +3 Query: 45 SPTCPTSATGSR-APRWPPTPSTGPSCSATRPTVISSIP 158 +PT P +AT + P PP +T P SA P S P Sbjct: 22 APTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPP 60 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 27.1 bits (57), Expect = 7.8 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +3 Query: 39 AGSPTCPTSATGSRAPRWPPTPSTGPSCSATRPTVISSIPRPP 167 A +P P T + AP PP P+ S P ++ P PP Sbjct: 357 ASTPLTPGQFTTANAPPAPPGPANQTSPPPPPPPSAAAPPPPP 399 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,327,378 Number of Sequences: 28952 Number of extensions: 174050 Number of successful extensions: 887 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 862 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 977150592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -