BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20154 (580 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0471 - 3672309-3672740,3673159-3673251,3673271-3673399,367... 31 0.66 01_01_0484 - 3558941-3559303,3559439-3559560,3560596-3560743,356... 30 1.2 09_02_0391 + 8482996-8483216,8484146-8484194,8484559-8487465 30 1.5 06_03_0269 - 18991203-18991307,18991448-18991525,18992724-189929... 28 4.7 06_03_0437 - 20765682-20765951,20766040-20766294,20766374-207665... 27 8.2 >12_01_0471 - 3672309-3672740,3673159-3673251,3673271-3673399, 3673400-3673448,3674291-3674378,3674477-3674573, 3675195-3675278,3675377-3675464,3676589-3676715, 3676774-3676848,3676934-3677042,3677125-3677448, 3677863-3678039 Length = 623 Score = 31.1 bits (67), Expect = 0.66 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 241 GSATCISWSDDSKYILQVNSKGLVEILSAADHDV 342 G+ C +WS D KY+L LV++ S D + Sbjct: 382 GALLCCTWSSDGKYLLTGGEDDLVQVWSMDDRKI 415 >01_01_0484 - 3558941-3559303,3559439-3559560,3560596-3560743, 3560853-3561491,3562154-3562450,3562553-3563407, 3564363-3564545,3565041-3565118,3565762-3565974, 3566075-3566238,3566357-3566445,3566761-3566891, 3566980-3567148,3567255-3567327,3567525-3567606, 3567677-3567808,3568743-3568818,3568965-3569065, 3569446-3569636,3569738-3569912,3570604-3570854, 3571327-3571603,3572184-3572267,3572496-3573206 Length = 1867 Score = 30.3 bits (65), Expect = 1.2 Identities = 22/77 (28%), Positives = 39/77 (50%) Frame = -3 Query: 434 YRSWSTAMLRWPSRWKLAHQLSFNDKCCKLRTS*SAADNISTKPFEFTCNMYLLSSLHEI 255 Y +W+ + LR SRW +Q+ F+D C + +S S N ST + + L L ++ Sbjct: 1386 YAAWAISFLR--SRWLSKNQIIFDDDCSQRNSSDS---NQSTSFSDESLVWNLSQWLRDL 1440 Query: 254 HVADPRNIRRTFSVPTL 204 + P ++ T +V T+ Sbjct: 1441 NFEKPDSMVSTSTVATV 1457 >09_02_0391 + 8482996-8483216,8484146-8484194,8484559-8487465 Length = 1058 Score = 29.9 bits (64), Expect = 1.5 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 352 VNSGRRDPLQIIFQLSLLNSPAICICCR 269 V+ GR+ P +IF N+ ++C CCR Sbjct: 75 VDEGRKTPKTLIFPRDERNASSVCRCCR 102 >06_03_0269 - 18991203-18991307,18991448-18991525,18992724-18992910, 18993096-18993265,18994228-18994306,18995006-18995220, 18995346-18995429,18995732-18995734 Length = 306 Score = 28.3 bits (60), Expect = 4.7 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -2 Query: 168 VKYIFLVIHQHLELRKLTYAEPVN*SIK-NLRVSNTIILNKTFMKNK 31 V + +IH +++ LTY +P I NL++ T IL + +K K Sbjct: 61 VPSVIYLIHNNVQFATLTYVDPSTYQIMGNLKIVTTGILFRLVLKRK 107 >06_03_0437 - 20765682-20765951,20766040-20766294,20766374-20766545, 20766964-20767097,20767205-20767288,20767369-20767659, 20767867-20768214,20768321-20768496,20768579-20768695, 20768780-20768936,20769110-20769225,20769323-20769483, 20769567-20769883,20769969-20770250,20770347-20770648, 20771977-20772067,20773203-20773256,20773723-20773812 Length = 1138 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -2 Query: 459 FFVSHIITLPFLVYGYVTMAISVETRTPTVF 367 FFVS+ L F YG +T+AIS +F Sbjct: 1000 FFVSYFSFLYFTYYGMMTVAISPNHEVAAIF 1030 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,253,643 Number of Sequences: 37544 Number of extensions: 274250 Number of successful extensions: 598 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 590 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 598 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1352600424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -