BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20143 (780 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_17017| Best HMM Match : TIL (HMM E-Value=4.8) 33 0.20 SB_35070| Best HMM Match : TIL (HMM E-Value=8.6) 33 0.20 SB_6589| Best HMM Match : zf-C2H2 (HMM E-Value=1.2e-36) 28 9.8 >SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = +3 Query: 696 KKRAPWLILPVVICLSPRLSHA 761 ++ A WLILPVVICLS RLSHA Sbjct: 126 RRVAIWLILPVVICLSQRLSHA 147 >SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = +3 Query: 696 KKRAPWLILPVVICLSPRLSHA 761 ++ A WLILPVVICLS RLSHA Sbjct: 102 RRVAIWLILPVVICLSQRLSHA 123 >SB_17017| Best HMM Match : TIL (HMM E-Value=4.8) Length = 171 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +3 Query: 696 KKRAPWLILPVVICLSPRLS 755 ++ A WLILPVVICLS RLS Sbjct: 147 RRVAIWLILPVVICLSQRLS 166 >SB_35070| Best HMM Match : TIL (HMM E-Value=8.6) Length = 147 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +3 Query: 696 KKRAPWLILPVVICLSPRLS 755 ++ A WLILPVVICLS RLS Sbjct: 123 RRVAIWLILPVVICLSQRLS 142 >SB_6589| Best HMM Match : zf-C2H2 (HMM E-Value=1.2e-36) Length = 651 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = -3 Query: 181 ATRKTNEHMKNFKISRTKKFMRPITKVSSSPQCIYVKLLTGQDIYERWIDTSD 23 AT K+N+ ++ + T + + + + PQC + G+D+ + DT D Sbjct: 442 ATSKSNQGVRKAEEKGTHQIDVQVMESTDIPQCHATNAIAGEDVKAKKEDTED 494 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,696,385 Number of Sequences: 59808 Number of extensions: 362621 Number of successful extensions: 637 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 637 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2131907602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -