BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20143 (780 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 26 1.5 AF525673-2|AAM82610.1| 58|Anopheles gambiae cecropin CecA prot... 24 4.6 AF200686-1|AAF22649.1| 58|Anopheles gambiae cecropin precursor... 24 4.6 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 25.8 bits (54), Expect = 1.5 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +3 Query: 651 VLRPMRCDVLVFELTKKRAPWLILPVVICLSPRLSHAFSVQAV 779 ++R R D+LV+E KKRA + + + + L + FS + + Sbjct: 1097 LIRANRPDILVYEKRKKRAT-IDIDIAVTLDHNVQTTFSTKVM 1138 >AF525673-2|AAM82610.1| 58|Anopheles gambiae cecropin CecA protein. Length = 58 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 529 IKFSRIWIFIYLMILFISKQRE 594 + FS+I+IF+ L +L + Q E Sbjct: 1 MNFSKIFIFVVLAVLLLCSQTE 22 >AF200686-1|AAF22649.1| 58|Anopheles gambiae cecropin precursor protein. Length = 58 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 529 IKFSRIWIFIYLMILFISKQRE 594 + FS+I+IF+ L +L + Q E Sbjct: 1 MNFSKIFIFVVLAVLLLCSQTE 22 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 712,657 Number of Sequences: 2352 Number of extensions: 12110 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81497388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -