BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20141 (742 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 23 2.0 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 4.5 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 4.5 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 22 6.0 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 7.9 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 587 HINKTKSGDSLENDYDIRYN 646 ++NK K G L N Y I YN Sbjct: 109 YVNKAKFGKLLINLYTINYN 128 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 369 DQKAKHLATKVLRVYNDNYEAIRGKLESTLAPGD 470 D+K K++ +V+RV +YE ++ S + P D Sbjct: 336 DEK-KYILQEVVRVKKPHYELNMVEVRSPVTPAD 368 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/57 (21%), Positives = 22/57 (38%) Frame = +2 Query: 488 SNHCALRDPKPKIKAEISKPYTATGKPPLLPRKHINKTKSGDSLENDYDIRYNEAFP 658 + HC + P P ++++I P P + T S +D ++ E P Sbjct: 400 AKHCGVNVPVPPMQSQIINPQPQITSPS-NTNTSTSSTNSNKPNSSDLNMLIKETMP 455 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 328 GLRSPQPQRNRRH 366 G R P P R+RRH Sbjct: 328 GRRGPGPARSRRH 340 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 7.9 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = -1 Query: 145 AW*WVQEWS 119 AW WV +WS Sbjct: 628 AWYWVMDWS 636 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,254 Number of Sequences: 336 Number of extensions: 3135 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -