BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20141 (742 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB095938-1|BAC23114.1| 1685|Homo sapiens KIAA2018 protein protein. 35 0.35 >AB095938-1|BAC23114.1| 1685|Homo sapiens KIAA2018 protein protein. Length = 1685 Score = 34.7 bits (76), Expect = 0.35 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +2 Query: 290 QEKRNHNPSDQTEDFEAH-NHNGTDDTRSKSQTPSHKGSESVQRQLRSH 433 Q+KRN QT H+GTD +RSK+ P H + +Q+Q++ H Sbjct: 962 QKKRNLVQGTQTSQLSLQPKHHGTDQSRSKTGQP-HPHHQQMQQQMQQH 1009 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,475,503 Number of Sequences: 237096 Number of extensions: 2069128 Number of successful extensions: 6711 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 6442 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6711 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8847149012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -