BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20139 (758 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 3.5 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 21 8.1 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 21 8.1 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 21 8.1 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = +1 Query: 190 GNGNHSPTGGPYARLPTRAIRKKSLDNTTTLTYSISRNLYRPS 318 G+GN+ P GGP + + + + K D + +S ++ + S Sbjct: 530 GSGNNQPPGGPSSHV-SAVLTCKVCDQAFSSLKELSNHMVKNS 571 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 21.4 bits (43), Expect = 8.1 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -3 Query: 111 LKGLLVFSECLASGSHGTRRYFWRRV 34 L L V +A G H RY W +V Sbjct: 136 LNTLTVVFMLIALGEHWLSRYSWAKV 161 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 21.4 bits (43), Expect = 8.1 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -3 Query: 111 LKGLLVFSECLASGSHGTRRYFWRRV 34 L L V +A G H RY W +V Sbjct: 136 LNTLTVVFMLIALGEHWLSRYSWAKV 161 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = +1 Query: 22 REKFHTPPKIP 54 REK +TPP++P Sbjct: 134 REKPYTPPRLP 144 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,119 Number of Sequences: 336 Number of extensions: 3871 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20338724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -