BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20139 (758 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC582.03 |cdc13||cyclin Cdc13|Schizosaccharomyces pombe|chr 2|... 29 0.54 SPAC2E1P3.01 |||zinc binding dehydrogenase|Schizosaccharomyces p... 26 6.7 SPCC1902.01 |gaf1|SPCC417.01c|transcription factor Gaf1 |Schizos... 25 8.9 >SPBC582.03 |cdc13||cyclin Cdc13|Schizosaccharomyces pombe|chr 2|||Manual Length = 482 Score = 29.5 bits (63), Expect = 0.54 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +3 Query: 15 NKEGKIPHASKNTSLYHENQTLNIRRKL 98 NKEG +P ASKNT++ H +++ RR L Sbjct: 70 NKEG-VPLASKNTNVRHTTASVSTRRAL 96 >SPAC2E1P3.01 |||zinc binding dehydrogenase|Schizosaccharomyces pombe|chr 1|||Manual Length = 348 Score = 25.8 bits (54), Expect = 6.7 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = -1 Query: 239 VGRRAY-GPPVGEWLPLPMDFSN-AWGRTVNYSIN 141 V R Y G V W P P+D SN AW + +N Sbjct: 71 VDRSKYIGATVSGWAPGPLDGSNAAWREYITLDVN 105 >SPCC1902.01 |gaf1|SPCC417.01c|transcription factor Gaf1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 855 Score = 25.4 bits (53), Expect = 8.9 Identities = 14/53 (26%), Positives = 27/53 (50%) Frame = +1 Query: 160 VLPQALLKSMGNGNHSPTGGPYARLPTRAIRKKSLDNTTTLTYSISRNLYRPS 318 VLP+ + S+ + P A LPT KK +++++I++N +P+ Sbjct: 561 VLPEGMAASLKKRTTNTAATPQAALPTTLDTKKD----RSVSFNINKNAEKPT 609 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,078,714 Number of Sequences: 5004 Number of extensions: 61806 Number of successful extensions: 150 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 150 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 363302114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -