BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20138 (682 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 24 1.2 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 3.6 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 24.2 bits (50), Expect = 1.2 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 134 SADSVQQGSIPG-SIRADSV*ELSCRHRSGWKTSGTGSVGY 253 +A S G P +I ADS EL R R G+K +G + Y Sbjct: 168 TAASTVLGFFPALNIVADSFIELIRRQRVGYKVTGFEELAY 208 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.6 bits (46), Expect = 3.6 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -1 Query: 298 WIRERPQPIVIFLARVSHRASSTC--FPSTSMSAT*FSNT 185 +I PQPI L++ +R +TC F T++S S T Sbjct: 696 FIEAEPQPIGKALSKCHNRNVTTCNMFRKTNLSGDSSSGT 735 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,206 Number of Sequences: 438 Number of extensions: 3925 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -