BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20137 (710 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_26621| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 28.7 bits (61), Expect = 4.9 Identities = 17/44 (38%), Positives = 27/44 (61%) Frame = +3 Query: 129 ILIIIKQLITHNT*DII*KCIDYCLSVCIMFTNIICFLNLTNYK 260 +LII++ +I H I+ + ID+C V I+F+ C L +T YK Sbjct: 860 VLIILQGIIDHAVLIILQEIIDHC--VLILFS---CSLEITGYK 898 >SB_26621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 359 Score = 28.3 bits (60), Expect = 6.5 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 5/61 (8%) Frame = +3 Query: 195 YCLSVCIMFTNIICFLNLTNYKSYTAAS-----RRRAWGMWIFKIIKYPLLKFSSTLHFF 359 Y + V + T +I ++L Y++ T +S RR + I PLL FSS+LHFF Sbjct: 111 YTVPVVSLLTLLI--ISLERYRAVTRSSCAAPPSRRQIAITILISWLIPLLMFSSSLHFF 168 Query: 360 N 362 + Sbjct: 169 D 169 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,757,843 Number of Sequences: 59808 Number of extensions: 345032 Number of successful extensions: 473 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 473 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -