BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20135 (664 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 23 3.4 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 6.0 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 22.6 bits (46), Expect = 3.4 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -1 Query: 169 IKYLLRQVFNKKKHSGFRQERISISTYCL*EIDYCYLLIY 50 I LL VF K SG+ R ++YCL D C+ Y Sbjct: 9 IAVLLAIVFLFDKCSGYPSIRQGTTSYCLGCGDSCHKCKY 48 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = -1 Query: 520 CWCSALFGRHPEVGGSGVEYHLERLR 443 C+C FGR + G + +L L+ Sbjct: 429 CYCPVRFGRKADPNGDYIRRYLPVLK 454 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,548 Number of Sequences: 438 Number of extensions: 4488 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -