BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20134 (705 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 25 0.79 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 21 7.4 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 24.6 bits (51), Expect = 0.79 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +2 Query: 254 IIEELRRMVRERG--ECIPRRVDDAYCLRFLRCRRF 355 I E L + + RG +P ++ D Y LR C RF Sbjct: 417 INEALLKRLNGRGVIHLVPSKIRDVYFLRLAICSRF 452 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 21.4 bits (43), Expect = 7.4 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 2/20 (10%) Frame = -3 Query: 265 LLDY--LCLVSGNSLQFFLA 212 L+D+ +CLV N QFFLA Sbjct: 16 LIDWYTVCLVPLNPYQFFLA 35 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,465 Number of Sequences: 336 Number of extensions: 3562 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -