BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20129 (723 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) 99 4e-21 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.95 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 30 2.2 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) 24 2.7 SB_3686| Best HMM Match : Myotub-related (HMM E-Value=2.8e-08) 29 3.8 SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) 28 6.7 SB_6613| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_50787| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_43823| Best HMM Match : MAM (HMM E-Value=0) 28 6.7 SB_36342| Best HMM Match : Viral_helicase1 (HMM E-Value=1.1) 28 6.7 SB_6893| Best HMM Match : PPV_E2_C (HMM E-Value=0.94) 28 6.7 SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_45329| Best HMM Match : Protamine_P2 (HMM E-Value=0.63) 28 8.8 SB_30225| Best HMM Match : Peptidase_S8 (HMM E-Value=0.0034) 25 9.7 >SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) Length = 710 Score = 98.7 bits (235), Expect = 4e-21 Identities = 43/60 (71%), Positives = 51/60 (85%) Frame = +2 Query: 53 TTMGDIEDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKV 232 T ++ DT F +G+SGAS T+P QCS+LRKNG V++KGRPCKIVEMSTSKTGKHGHAKV Sbjct: 585 TMAEELADTEFHSGESGASDTYPAQCSSLRKNGHVVIKGRPCKIVEMSTSKTGKHGHAKV 644 Score = 68.1 bits (159), Expect = 7e-12 Identities = 28/62 (45%), Positives = 43/62 (69%) Frame = +1 Query: 331 QLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLRTDFDSGKELLCTVLKSCGEECVIA 510 ++T+I +DGYL LM DNGD R D+K+ D D+ ++R F++ + + TVLK+ GEE V+ Sbjct: 643 KVTNIEEDGYLELMDDNGDTRADIKLQDNDIAKEIRAKFEASENFMVTVLKAMGEETVVG 702 Query: 511 SK 516 K Sbjct: 703 VK 704 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 31.1 bits (67), Expect = 0.95 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 530 ESC--VCFDAMTHSSPQDFSTVHNNSLPLSKSVRNCVPRSPS 411 +SC +CF + S P + H+N+ P S NC P PS Sbjct: 1285 QSCPKICFTSCKPSCPVHCCSEHSNACPQECSTDNCKPSCPS 1326 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +3 Query: 66 TSKTHTLRPETPGPQPPSPCNVRPCVKTVSLC*RVVH-ARLLKCPH 200 T+K HT +P T P P N+ P + + +L ++H + PH Sbjct: 168 TTKPHTTKPHTTKPHTTKPHNIDPTLPSPTLLNALLHFLYFYQAPH 213 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +3 Query: 18 HISFLTVVKFKTQQWVTSKTHTLRPETPGPQPPSPCNVRPC 140 H L K KT + T+K +T +P T P+ P +PC Sbjct: 92 HTIKLYTTKPKTTKPHTNKPYTTKPRTTKPRTTKPHTTKPC 132 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 29.9 bits (64), Expect = 2.2 Identities = 19/52 (36%), Positives = 25/52 (48%) Frame = +3 Query: 54 QQWVTSKTHTLRPETPGPQPPSPCNVRPCVKTVSLC*RVVHARLLKCPHPKP 209 +Q V S P P P PP+PC + PC +T +VVH+ L P P Sbjct: 126 EQHVVSHVMHPAPPPPPPPPPAPC-MPPCHQT-----QVVHSVQLHASPPGP 171 >SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) Length = 458 Score = 24.2 bits (50), Expect(2) = 2.7 Identities = 13/54 (24%), Positives = 27/54 (50%) Frame = +3 Query: 117 SPCNVRPCVKTVSLC*RVVHARLLKCPHPKPESTATLKFTWLGLISQW*KV*RY 278 +PC ++ C + +S+ V ++K P P TL ++G ++ K+ +Y Sbjct: 398 NPCRIQYCTQEISMTPIHVLLLIVKAPILDPSLVVTLCSRFIGHQARKLKIVKY 451 Score = 23.8 bits (49), Expect(2) = 2.7 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 99 PGPQPPSPCNVRP 137 PGPQ P P N+ P Sbjct: 362 PGPQDPGPGNILP 374 >SB_3686| Best HMM Match : Myotub-related (HMM E-Value=2.8e-08) Length = 629 Score = 29.1 bits (62), Expect = 3.8 Identities = 17/64 (26%), Positives = 29/64 (45%) Frame = +1 Query: 238 GWD*YLNGKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDG 417 GWD + N + +C ST + + HV +Y+ + L N +ED K+ + Sbjct: 204 GWDMFSNDLDFAKVCSSTQSWRISHV-NINYESVLMRSGEPLCGSMSNKRCKEDEKLVNS 262 Query: 418 DLGT 429 LG+ Sbjct: 263 ALGS 266 >SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1671 Score = 28.7 bits (61), Expect = 5.0 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +1 Query: 256 NGKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNG 384 NG Y CP N D + EDY + D YLT D G Sbjct: 400 NGHTYHMTCPGQTNFDPAKKRCEDYDCSG-RDVAYLTDQNDGG 441 >SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1438 Score = 28.7 bits (61), Expect = 5.0 Identities = 19/82 (23%), Positives = 33/82 (40%) Frame = +1 Query: 283 PSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLRTDFDSGKE 462 P + + V + +++ D + ADN + RE+ + +L ++ T G Sbjct: 284 PESDGIRVDETENGEHEAVDELPEDKPDTEADNYEQREETPTKEDELKSECTTSDSEGTP 343 Query: 463 LLCTVLKSCGEECVIASKQTQL 528 T KS GEE V + L Sbjct: 344 SAATYGKSDGEENVAQESEESL 365 >SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) Length = 492 Score = 28.3 bits (60), Expect = 6.7 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = -2 Query: 491 PQDFSTVHNNSLPLSKSVRNCVPRSPSGILRSSRRSPLSAIRVR 360 P+ S V + +LP+ V C+P SPS I RS P VR Sbjct: 253 PRQISNVRSLTLPVRYQVIGCLP-SPSDIKRSVPYPPRQISNVR 295 >SB_6613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 523 Score = 28.3 bits (60), Expect = 6.7 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 4/82 (4%) Frame = +1 Query: 298 MDVPHVKREDYQLTDISDDGYLT----LMADNGDLREDLKIPDGDLGTQLRTDFDSGKEL 465 +D+P+ K + + L ++DD L+ + D L E L PD + R D G E Sbjct: 37 LDIPYEKYDKFDLESLTDDECLSEFRFIKNDLYRLNEALNFPD-QITCPNRLTVD-GMEA 94 Query: 466 LCTVLKSCGEECVIASKQTQLS 531 LC L+ C Q+S Sbjct: 95 LCMTLRRFAYPCRYEDLVPQIS 116 >SB_50787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 599 Score = 28.3 bits (60), Expect = 6.7 Identities = 16/58 (27%), Positives = 26/58 (44%) Frame = -3 Query: 310 GVRPCCVWRDRYLHTFYH*DINPNQVNFSVAVLSGFGCGHFNNLAWTTLQHNETVFTQ 137 G+R C D L F + + + + S A ++ +G GH N + L H + TQ Sbjct: 243 GLRSCITHGDDLLSVFDNMESSSKVFDMSNAPVTRYGLGHVNQILEEELSHLRFLKTQ 300 >SB_43823| Best HMM Match : MAM (HMM E-Value=0) Length = 1724 Score = 28.3 bits (60), Expect = 6.7 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = -2 Query: 155 RNRFYAGPNIAW--GRWLRPRSLRSQSV 78 R F+ PN+A G+WL P+SLR+ V Sbjct: 947 REGFFNNPNLAGCKGQWLGPKSLRASRV 974 >SB_36342| Best HMM Match : Viral_helicase1 (HMM E-Value=1.1) Length = 872 Score = 28.3 bits (60), Expect = 6.7 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 4/94 (4%) Frame = +1 Query: 274 DICPSTHNMDVPHVKREDYQLTDISDDGYLTLM----ADNGDLREDLKIPDGDLGTQLRT 441 D+ S H +D+P+ E++ + +D ++ +D L E L+IPD T + Sbjct: 592 DLNTSNH-IDLPYNSYENFDFDILEEDECMSEFRFHKSDIPLLAEMLQIPDRL--TLYQR 648 Query: 442 DFDSGKELLCTVLKSCGEECVIASKQTQLSTNKP 543 SG E LC VLK C A + S P Sbjct: 649 SVCSGLEALCIVLKRLAYPCRYADMVAKFSRPVP 682 >SB_6893| Best HMM Match : PPV_E2_C (HMM E-Value=0.94) Length = 1058 Score = 28.3 bits (60), Expect = 6.7 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +3 Query: 33 TVVKFKTQQWVTSKTHTLRPETPGPQPPSPCNVRP 137 +VV + VT K T +P TP P P P RP Sbjct: 758 SVVAMPAARPVTPKPVTPKPVTPKPVTPKPVTTRP 792 >SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 28.3 bits (60), Expect = 6.7 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 143 KNGFVMLKGRPCKIV-EMSTSKTGKHGHAKVHLVG 244 + G +M +G+PCKI + K G HG +H+ G Sbjct: 17 RRGVMMAEGKPCKITGTIEGLKAGNHGF-HIHVYG 50 >SB_45329| Best HMM Match : Protamine_P2 (HMM E-Value=0.63) Length = 474 Score = 27.9 bits (59), Expect = 8.8 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +2 Query: 167 GRPCKIVEMSTSKTGKHGHAKVHLVGIDISMVKSMKISVPPHTTWTYPT 313 G+ + M S + G+ K LV IS ++++ +++PPHT PT Sbjct: 421 GQKTRPGRMKKSTSLDSGNVK-RLVDESISAIETVNVALPPHTLKPQPT 468 >SB_30225| Best HMM Match : Peptidase_S8 (HMM E-Value=0.0034) Length = 605 Score = 25.0 bits (52), Expect(2) = 9.7 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +3 Query: 72 KTHTLRPETPGPQPPSP 122 K H +P P P PPSP Sbjct: 344 KEHPDKPRDPAPVPPSP 360 Score = 21.0 bits (42), Expect(2) = 9.7 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 Query: 96 TPGPQPPSPCNVRPCVKT 149 T GP PP+ N +P T Sbjct: 377 TFGPPPPAASNAKPAQYT 394 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,451,741 Number of Sequences: 59808 Number of extensions: 545555 Number of successful extensions: 1498 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1340 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1489 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1925890720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -