BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20129 (723 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 25 2.4 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 25 2.4 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 4.1 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 24 4.1 AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. 24 5.5 AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. 24 5.5 AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. 24 5.5 AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. 24 5.5 AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. 24 5.5 DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. 23 7.2 AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled ... 23 7.2 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 23 9.6 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 25.0 bits (52), Expect = 2.4 Identities = 22/81 (27%), Positives = 40/81 (49%), Gaps = 1/81 (1%) Frame = +1 Query: 286 STHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLRTDFDSGKEL 465 ST+N +P++ TD++D + MA +GD DL + + + SG + Sbjct: 166 STNNSVLPYITESP---TDLTDAPTTSNMAASGD-ETDLDAITTLAESGIPSSNTSGDDR 221 Query: 466 LCTVLKSCGEEC-VIASKQTQ 525 + +L S E+C ++ASK + Sbjct: 222 VDHLLPSPAEQCRILASKPAE 242 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 25.0 bits (52), Expect = 2.4 Identities = 22/81 (27%), Positives = 40/81 (49%), Gaps = 1/81 (1%) Frame = +1 Query: 286 STHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLRTDFDSGKEL 465 ST+N +P++ TD++D + MA +GD DL + + + SG + Sbjct: 167 STNNSVLPYITESP---TDLTDAPTTSNMAASGD-ETDLDAITTLAESGIPSSNTSGDDR 222 Query: 466 LCTVLKSCGEEC-VIASKQTQ 525 + +L S E+C ++ASK + Sbjct: 223 VDHLLPSPAEQCRILASKPAE 243 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 24.2 bits (50), Expect = 4.1 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -2 Query: 512 DAMTHSSPQDFSTVHNNSLPLSKSVRNCVPRSPSGILRSSRRS 384 DAM SSP S N S+ ++S + + G++ +RRS Sbjct: 647 DAMASSSPASCSPEQNGSMTKTRSYSDIKEATSGGVM--ARRS 687 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 24.2 bits (50), Expect = 4.1 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -2 Query: 512 DAMTHSSPQDFSTVHNNSLPLSKSVRNCVPRSPSGILRSSRRS 384 DAM SSP S N S+ ++S + + G++ +RRS Sbjct: 647 DAMASSSPASCSPEQNGSMTKTRSYSDIKEATSGGVM--ARRS 687 >AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 5.5 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 376 DNGDLREDLKIPDGDLGTQLRTDFDSGKELL 468 + GD ED+ PDGD G R FD+ K L Sbjct: 60 EEGDYTEDVTAPDGD-G---RWTFDTNKPAL 86 >AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 5.5 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 376 DNGDLREDLKIPDGDLGTQLRTDFDSGKELL 468 + GD ED+ PDGD G R FD+ K L Sbjct: 60 EEGDYTEDVTAPDGD-G---RWTFDTNKPAL 86 >AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 5.5 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 376 DNGDLREDLKIPDGDLGTQLRTDFDSGKELL 468 + GD ED+ PDGD G R FD+ K L Sbjct: 60 EEGDYTEDVTAPDGD-G---RWTFDTNKPAL 86 >AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. Length = 187 Score = 23.8 bits (49), Expect = 5.5 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 376 DNGDLREDLKIPDGDLGTQLRTDFDSGKELL 468 + GD ED+ PDGD G R FD+ K L Sbjct: 60 EEGDYTEDVTAPDGD-G---RWTFDTNKPAL 86 >AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 5.5 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 376 DNGDLREDLKIPDGDLGTQLRTDFDSGKELL 468 + GD ED+ PDGD G R FD+ K L Sbjct: 60 EEGDYTEDVTAPDGD-G---RWTFDTNKPAL 86 >DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. Length = 511 Score = 23.4 bits (48), Expect = 7.2 Identities = 12/51 (23%), Positives = 24/51 (47%) Frame = +1 Query: 268 YEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGD 420 Y+D+ + ++V ++R DY + L + ++ E+ PDGD Sbjct: 65 YKDVLEQNYAVEVRDIERNDYNFDEPKTS--LDPVVVEEEIIEESNGPDGD 113 >AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled receptor 4 protein. Length = 426 Score = 23.4 bits (48), Expect = 7.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 116 FPMQCSALRKNGFVMLKG 169 +P++ SA RK G +ML G Sbjct: 181 YPLRVSAARKRGKIMLGG 198 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 23.0 bits (47), Expect = 9.6 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +3 Query: 87 RPETPGPQPPSPCNVRPCVKTVSL 158 R +TPG PPS VR KT+SL Sbjct: 888 RVKTPGDVPPSVRKVR-ASKTLSL 910 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 817,784 Number of Sequences: 2352 Number of extensions: 16591 Number of successful extensions: 40 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -