BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20128 (704 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0941 - 20950190-20951088,20952436-20952478,20952580-209526... 28 6.3 05_03_0430 - 13945146-13945354,13945550-13946135,13946396-139464... 28 8.3 >04_03_0941 - 20950190-20951088,20952436-20952478,20952580-20952606, 20953189-20953301,20953872-20954715,20955740-20955790, 20956026-20956126,20956205-20956244,20956360-20957124 Length = 960 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 682 KW*YKIGSPPPAGSKMDVFKFRSVNNIVIAPAKTGSDNNNKNAV 551 K+ Y+IG G + D +S +N V PA DNN + A+ Sbjct: 305 KYCYRIGLVKVQGLRCDARNLKSPHNAVTDPAIEDLDNNLQQAI 348 >05_03_0430 - 13945146-13945354,13945550-13946135,13946396-13946477, 13946584-13946942 Length = 411 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -2 Query: 436 NVVKKIARSTDLPLCAILDESGG*TVHPVPAPFSTILLEINNI 308 N+ ++IAR P+CA G T+H VP P +E+ ++ Sbjct: 249 NITQEIARGVAHPICA------GQTIHGVPLPVGHSRVEVEDV 285 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,943,293 Number of Sequences: 37544 Number of extensions: 250442 Number of successful extensions: 468 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -