BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20126 (654 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 26 0.31 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 5.1 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 21 6.7 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 25.8 bits (54), Expect = 0.31 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 Query: 287 LVSSKWFFPRWAQAL 331 L+ K+FFPRW Q L Sbjct: 646 LILDKFFFPRWRQTL 660 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 373 SKPNTATDDFKNNKPNILSLH 435 S NT+T +NKPN L+ Sbjct: 427 SNTNTSTSSTNSNKPNSSDLN 447 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 21.4 bits (43), Expect = 6.7 Identities = 10/42 (23%), Positives = 18/42 (42%) Frame = +3 Query: 165 HPWETVAQAAWRKYPNPMNPAVIGTDVVERKL*MVYFILIDW 290 H W T+ + + ++ G +V L +V F+L W Sbjct: 93 HKWSTLFEILLKLESKDLSRTFYGFVIVAHLLFLVIFVLNIW 134 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,966 Number of Sequences: 336 Number of extensions: 3675 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -