BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20124 (651 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding prote... 23 2.6 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 7.8 >AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding protein ASP5 protein. Length = 143 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +1 Query: 412 FNFDMLSTISLLFVPIIEVSVTKYFLSICR 501 F+FDM+ + +P EV + K +++CR Sbjct: 84 FDFDMIVKQLEITMPPEEVVIGKEIVAVCR 113 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 526 LYQQSDINIDKLTRNTW 476 +YQ SD + +LT NT+ Sbjct: 218 MYQNSDDSFHRLTSNTF 234 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,841 Number of Sequences: 438 Number of extensions: 2972 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -