BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20122 (642 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024796-2|AAK29892.2| 446|Caenorhabditis elegans Hypothetical ... 28 4.9 AF026212-2|AAF99972.1| 1009|Caenorhabditis elegans Hypothetical ... 28 6.5 >AC024796-2|AAK29892.2| 446|Caenorhabditis elegans Hypothetical protein Y48G1C.4 protein. Length = 446 Score = 28.3 bits (60), Expect = 4.9 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 5/75 (6%) Frame = +3 Query: 195 ISDSSIVVKNEQCIAAVALD-FPF-GSTHRSRQ-IQQRVRNTTH*VSHRIQQSPVLVKVD 365 ++DSS +V+NEQ + + D P+ GS H R+ ++ RV + S + D Sbjct: 182 VADSSFIVENEQLVPSPKCDVHPYLGSAHLYREMLKTRVNRVIEKYKESRKTSSNCMSAD 241 Query: 366 --IYLTKKVGL*YIH 404 IY ++GL IH Sbjct: 242 TWIYPVLQMGLLGIH 256 >AF026212-2|AAF99972.1| 1009|Caenorhabditis elegans Hypothetical protein F52G3.4 protein. Length = 1009 Score = 27.9 bits (59), Expect = 6.5 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -1 Query: 300 LFVGFDGNGEWIQKESRGRQPLCIVHSSPQSTNPIF 193 LF+ F GN EW + + ++ C + +P N +F Sbjct: 823 LFITFTGNPEWKEIQEYTKEKNCKWYHAPAFVNAVF 858 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,928,908 Number of Sequences: 27780 Number of extensions: 314027 Number of successful extensions: 720 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 719 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1427403330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -