BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20122 (642 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g33010.1 68417.m04695 glycine dehydrogenase [decarboxylating]... 28 4.6 At2g41430.4 68415.m05115 dehydration-induced protein (ERD15) ide... 27 8.0 At2g41430.2 68415.m05114 dehydration-induced protein (ERD15) ide... 27 8.0 At2g41430.1 68415.m05113 dehydration-induced protein (ERD15) ide... 27 8.0 >At4g33010.1 68417.m04695 glycine dehydrogenase [decarboxylating], putative / glycine decarboxylase, putative / glycine cleavage system P-protein, putative strong similarity to SP|P49361 Glycine dehydrogenase [decarboxylating] A, mitochondrial precursor (EC 1.4.4.2) {Flaveria pringlei}; contains Pfam profile PF02347: Glycine cleavage system P-protein Length = 1037 Score = 28.3 bits (60), Expect = 4.6 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +2 Query: 539 KTLVLSINYIAKRLPHPSKQNVLLFRGRNRTV 634 K +L+ NY+AKRL K +LFRG N TV Sbjct: 854 KIAILNANYMAKRL---EKHYPVLFRGVNGTV 882 >At2g41430.4 68415.m05115 dehydration-induced protein (ERD15) identical to dehydration-induced protein ERD15 GI:710626 from [Arabidopsis thaliana] Length = 163 Score = 27.5 bits (58), Expect = 8.0 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 291 GFDGNGEWIQKESRGRQPLCIVHSSPQSTNP 199 GF NGE ++K S R P IV + + P Sbjct: 114 GFGKNGEMVKKSSGNRSPRSIVEPAKYAEKP 144 >At2g41430.2 68415.m05114 dehydration-induced protein (ERD15) identical to dehydration-induced protein ERD15 GI:710626 from [Arabidopsis thaliana] Length = 163 Score = 27.5 bits (58), Expect = 8.0 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 291 GFDGNGEWIQKESRGRQPLCIVHSSPQSTNP 199 GF NGE ++K S R P IV + + P Sbjct: 114 GFGKNGEMVKKSSGNRSPRSIVEPAKYAEKP 144 >At2g41430.1 68415.m05113 dehydration-induced protein (ERD15) identical to dehydration-induced protein ERD15 GI:710626 from [Arabidopsis thaliana] Length = 163 Score = 27.5 bits (58), Expect = 8.0 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 291 GFDGNGEWIQKESRGRQPLCIVHSSPQSTNP 199 GF NGE ++K S R P IV + + P Sbjct: 114 GFGKNGEMVKKSSGNRSPRSIVEPAKYAEKP 144 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,993,776 Number of Sequences: 28952 Number of extensions: 290389 Number of successful extensions: 686 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 666 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 686 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -