BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20121 (680 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4H3.12c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 28 1.4 SPBPB8B6.03 ||SPAPB8B6.03, SPAPB8B6.03|acetamidase |Schizosaccha... 26 4.4 SPBC1683.11c |||isocitrate lyase|Schizosaccharomyces pombe|chr 2... 25 7.7 >SPAC4H3.12c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 101 Score = 27.9 bits (59), Expect = 1.4 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = +3 Query: 555 LNTIICIYYIYQAA 596 LNTI+CI+Y+Y+ A Sbjct: 36 LNTIVCIFYVYKIA 49 >SPBPB8B6.03 ||SPAPB8B6.03, SPAPB8B6.03|acetamidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 547 Score = 26.2 bits (55), Expect = 4.4 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +2 Query: 407 LQNLSLKNNILVGNWNSFTSTGAHCCRRVL 496 L L L NI GN+ S+ T A C R L Sbjct: 60 LSMLELATNIAKGNYTSYNVTKAFCHRAAL 89 >SPBC1683.11c |||isocitrate lyase|Schizosaccharomyces pombe|chr 2|||Manual Length = 518 Score = 25.4 bits (53), Expect = 7.7 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = +1 Query: 421 LEK*YSSRQLEFVHEYGGTLLSTRIRRPFTASVGAAPTNAT 543 LE+ +++E + ++ T ++I+RP+TAS A + T Sbjct: 7 LEQLEYEKEVEEIEKWWATPKQSQIKRPYTASTVAVLSEVT 47 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,670,484 Number of Sequences: 5004 Number of extensions: 51574 Number of successful extensions: 120 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 313902888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -