Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20117
         (746 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439353-11|CAD27933.1|  615|Anopheles gambiae 30E5.11 protein.        27   0.81 
AY263175-1|AAP78790.1|  814|Anopheles gambiae TmcA-like protein ...    24   5.7  

>AJ439353-11|CAD27933.1|  615|Anopheles gambiae 30E5.11 protein.
          Length = 615

 Score = 26.6 bits (56), Expect = 0.81
 Identities = 11/32 (34%), Positives = 18/32 (56%)
 Frame = +3

Query: 45  WKKSLTDSRKYARVCCQRRKMIRMNLKR*SKR 140
           WKK ++ + K   V CQ+ +  R  L+  SK+
Sbjct: 87  WKKVVSPAEKETEVLCQQEREFREYLRNGSKK 118


>AY263175-1|AAP78790.1|  814|Anopheles gambiae TmcA-like protein
           protein.
          Length = 814

 Score = 23.8 bits (49), Expect = 5.7
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 459 LRWAFKINIIIS 494
           LRW F +NI+IS
Sbjct: 156 LRWLFSVNIVIS 167


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 709,172
Number of Sequences: 2352
Number of extensions: 12819
Number of successful extensions: 17
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 76923555
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)