BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20117 (746 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 27 0.81 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 24 5.7 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 26.6 bits (56), Expect = 0.81 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 45 WKKSLTDSRKYARVCCQRRKMIRMNLKR*SKR 140 WKK ++ + K V CQ+ + R L+ SK+ Sbjct: 87 WKKVVSPAEKETEVLCQQEREFREYLRNGSKK 118 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 23.8 bits (49), Expect = 5.7 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 459 LRWAFKINIIIS 494 LRW F +NI+IS Sbjct: 156 LRWLFSVNIVIS 167 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 709,172 Number of Sequences: 2352 Number of extensions: 12819 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -