BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20117 (746 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14580.1 68417.m02244 CBL-interacting protein kinase 4 (CIPK4... 29 2.5 At5g24110.1 68418.m02833 WRKY family transcription factor 27 10.0 >At4g14580.1 68417.m02244 CBL-interacting protein kinase 4 (CIPK4) identical to CBL-interacting protein kinase 4 [Arabidopsis thaliana] gi|13249503|gb|AAG01367; identical to cDNA calcineurin B-like (CBL) interacting protein kinase 4 (CIPK4) GI:13249502 Length = 426 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 291 ETARELGHGAGRRPHVSRSI*VGRLIIVQLL 383 E R LG G+ + HV+RSI G L+ ++++ Sbjct: 22 ELGRRLGSGSFAKVHVARSISTGELVAIKII 52 >At5g24110.1 68418.m02833 WRKY family transcription factor Length = 303 Score = 27.5 bits (58), Expect = 10.0 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 239 NQVRFHSNLDSIDRAIRLYLLRKHQHLPNLHSP 141 NQ + H NLD + ++ Y + H H NLH P Sbjct: 190 NQTQEHGNLDMVKESVDNYNHQAHLH-HNLHYP 221 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,475,118 Number of Sequences: 28952 Number of extensions: 277095 Number of successful extensions: 657 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 642 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 657 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1653386488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -