BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20115 (805 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 25 0.71 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 22 6.6 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 25.0 bits (52), Expect = 0.71 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = +1 Query: 586 RESEPEVRQAAAYGCGVLAQFGDVQFAAACARAVPLFGALSQ 711 ++ P VR+AAA G LAQ ++++ +P+F +L+Q Sbjct: 177 QDDTPMVRRAAATKLGELAQVVELEYLK--TDLIPMFLSLTQ 216 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 577 NALRESEPEVRQAAA 621 N L+++E EVR AAA Sbjct: 291 NLLKDTEAEVRAAAA 305 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.8 bits (44), Expect = 6.6 Identities = 6/18 (33%), Positives = 11/18 (61%) Frame = -3 Query: 347 PHYLHQLIVLLRPHHNLR 294 P++ H+L PHH ++ Sbjct: 93 PNWWHELETKFNPHHEIK 110 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,077 Number of Sequences: 336 Number of extensions: 4038 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21895259 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -