Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20113
         (750 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_01_0460 + 3561490-3564104,3564162-3564558                           28   9.1  

>11_01_0460 + 3561490-3564104,3564162-3564558
          Length = 1003

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 6/51 (11%)
 Frame = -3

Query: 307 LAGRFPYTLYNIKVL------KKKIEVSIRANTAGSVEDLPFYQLDYN*YF 173
           LAGRFP  + NI  +         +   I +N   S+ ++ ++++DYN +F
Sbjct: 206 LAGRFPRAILNIFTIVGLAFSSNYLNGEIPSNLFDSLPEMQWFEVDYNNFF 256


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,499,857
Number of Sequences: 37544
Number of extensions: 336659
Number of successful extensions: 556
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 549
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 556
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1992480932
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)