BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20113 (750 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40415-9|AAK39249.3| 281|Caenorhabditis elegans Hypothetical pr... 29 3.5 Z74031-1|CAA98460.1| 140|Caenorhabditis elegans Hypothetical pr... 28 8.1 >U40415-9|AAK39249.3| 281|Caenorhabditis elegans Hypothetical protein K02G10.1 protein. Length = 281 Score = 29.1 bits (62), Expect = 3.5 Identities = 10/28 (35%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -2 Query: 386 LFWAQINRPVVLPHITLFL-TFIYYWLP 306 LFW I + +PH+ ++ T + YW P Sbjct: 180 LFWCAIGLTIAMPHLFFYMNTEVAYWYP 207 >Z74031-1|CAA98460.1| 140|Caenorhabditis elegans Hypothetical protein F32B6.11 protein. Length = 140 Score = 27.9 bits (59), Expect = 8.1 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 10/51 (19%) Frame = -2 Query: 359 VVLPHITLFLTFIYYWLPGW--KIPLHPV-----*HKS---SQKENRSVHP 237 V LP I+L + +IY W PG+ K P P+ HKS SQK R + P Sbjct: 51 VSLPAISLSVYYIYIWDPGYITKYPADPINKTVTIHKSPILSQKVERDLLP 101 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,176,350 Number of Sequences: 27780 Number of extensions: 333781 Number of successful extensions: 701 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 689 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1777507862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -