BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20112 (751 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0341 + 3011238-3011246,3011824-3012192,3012412-3012505,301... 29 5.2 02_04_0622 - 24508508-24508666,24509533-24509634,24510108-245101... 29 5.2 03_05_0331 - 23233883-23233972,23234099-23234164,23234300-232343... 28 9.1 >08_01_0341 + 3011238-3011246,3011824-3012192,3012412-3012505, 3012594-3012631,3012862-3013008,3013912-3014011, 3014615-3015042,3015234-3015389 Length = 446 Score = 28.7 bits (61), Expect = 5.2 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 541 ILVLFRNTLSRFSWY--FGFCWLLLLPFVEKSSVK 639 ILV L F ++ + FCW LLLP+VE VK Sbjct: 363 ILVHGSGRLRLFCFFIAYQFCWHLLLPYVEYVKVK 397 >02_04_0622 - 24508508-24508666,24509533-24509634,24510108-24510176, 24510294-24510362,24510428-24510502,24510584-24510688, 24511309-24511407,24511521-24513230,24513489-24513788, 24514748-24514846,24514962-24515079,24515166-24515251, 24515334-24515402,24515746-24515843,24516373-24516534, 24516779-24516787,24516970-24516991,24517620-24517712, 24517872-24517940,24518720-24518782,24518882-24519037, 24520895-24521230 Length = 1355 Score = 28.7 bits (61), Expect = 5.2 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -1 Query: 634 RKIFQQMVTVTTNKNRSTKRIWTKYSGRELKLTL 533 R+ QQ+VT +TN + S IWTKY + L L Sbjct: 1143 REALQQLVTASTNNDNS---IWTKYFNQILTTIL 1173 >03_05_0331 - 23233883-23233972,23234099-23234164,23234300-23234365, 23234451-23234675,23234794-23235279 Length = 310 Score = 27.9 bits (59), Expect = 9.1 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 Query: 92 DTPNHYYIHCSGKS 133 DTP+ YY+HC+G S Sbjct: 52 DTPSAYYLHCNGGS 65 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,077,427 Number of Sequences: 37544 Number of extensions: 304993 Number of successful extensions: 757 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 757 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -