BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20109 (593 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. 26 0.80 AY341235-1|AAR13799.1| 196|Anopheles gambiae transferrin-like p... 26 0.80 AY341234-1|AAR13798.1| 196|Anopheles gambiae transferrin-like p... 26 0.80 AY341232-1|AAR13796.1| 196|Anopheles gambiae transferrin-like p... 26 0.80 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 25 1.8 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 25 1.8 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 25 1.8 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 25 1.8 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 25 1.8 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription fact... 24 3.2 DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription fact... 24 3.2 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 24 3.2 DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 23 5.6 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 23 5.6 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 23 7.4 DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 23 9.8 >DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. Length = 482 Score = 26.2 bits (55), Expect = 0.80 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 115 EGEEKKDDKAIEPPMDPNV 171 E EE DD+ +E P++PNV Sbjct: 162 EDEEYDDDQYLEEPIEPNV 180 >AY341235-1|AAR13799.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 26.2 bits (55), Expect = 0.80 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +1 Query: 16 GTYEPNDDECLN---PWRDDTEE 75 GTY+ DDE LN P DD EE Sbjct: 143 GTYQATDDEGLNTDSPLEDDAEE 165 >AY341234-1|AAR13798.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 26.2 bits (55), Expect = 0.80 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +1 Query: 16 GTYEPNDDECLN---PWRDDTEE 75 GTY+ DDE LN P DD EE Sbjct: 143 GTYQATDDEGLNTDSPLEDDAEE 165 >AY341232-1|AAR13796.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 26.2 bits (55), Expect = 0.80 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +1 Query: 16 GTYEPNDDECLN---PWRDDTEE 75 GTY+ DDE LN P DD EE Sbjct: 143 GTYQATDDEGLNTDSPLEDDAEE 165 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 25.0 bits (52), Expect = 1.8 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = -3 Query: 183 WDTLYIGIHWRLDSLVILLFLTLSDGSILYRP 88 WDT Y + W D++ +F+ + ++++RP Sbjct: 121 WDTYYKNMIWARDNINEGMFIYVLHLTVMHRP 152 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 25.0 bits (52), Expect = 1.8 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +3 Query: 276 KVQMHEDPISFTLEFYFAPNEYFTNTVLTKEY 371 ++Q H DP+ + F P YFT + Y Sbjct: 21 RIQGHSDPLGHSTPGSFDPQGYFTPPIANVGY 52 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.0 bits (52), Expect = 1.8 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = -3 Query: 183 WDTLYIGIHWRLDSLVILLFLTLSDGSILYRP 88 WDT Y + W D++ +F+ + ++++RP Sbjct: 121 WDTYYKNMIWARDNINEGMFIYVLHLTVMHRP 152 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.0 bits (52), Expect = 1.8 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = -3 Query: 183 WDTLYIGIHWRLDSLVILLFLTLSDGSILYRP 88 WDT Y + W D++ +F+ + ++++RP Sbjct: 121 WDTYYKNMIWARDNINEGMFIYVLHLTVMHRP 152 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.0 bits (52), Expect = 1.8 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = -3 Query: 183 WDTLYIGIHWRLDSLVILLFLTLSDGSILYRP 88 WDT Y + W D++ +F+ + ++++RP Sbjct: 121 WDTYYKNMIWARDNINEGMFIYVLHLTVMHRP 152 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 32 FTFSFYTPALDYYLNHPIRKYIILKDLPD 60 >DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 32 FTFSFYTPALDYYLNHPIRKYIILKDLPD 60 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 306 FTLEFYFAPNEYFTNTVLTKEYLMKCKPD 392 FT FY +Y+ N + K ++K PD Sbjct: 43 FTFSFYTPALDYYLNHPIRKYIILKDLPD 71 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 23.4 bits (48), Expect = 5.6 Identities = 7/28 (25%), Positives = 16/28 (57%) Frame = +1 Query: 235 QEHDEPI*NACKILKCKCMKTP*ASLWN 318 +E D+ + C+ + +C++ +LWN Sbjct: 115 KERDDAVAKLCRTMDVRCVENVSHTLWN 142 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.4 bits (48), Expect = 5.6 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +1 Query: 1 RHEVNGTYEPNDDECLNPWRDDTEEEEL--ARAVQNAAITEGEEKK 132 R E++G Y+P + DD E + A + AA T EE + Sbjct: 1109 RAEMHGAYQPAPSNDSDDDDDDVENRQATNAASTSEAARTAAEESR 1154 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 23.0 bits (47), Expect = 7.4 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 336 EYFTNTVLTKEYLMKCKPDEES 401 EY T ++ YL CK EES Sbjct: 228 EYLTRLYVSYRYLQLCKGVEES 249 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 22.6 bits (46), Expect = 9.8 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 341 VFIWSKVEFQSEAYGVFMHLH 279 V IWS + YG++M LH Sbjct: 215 VLIWSFAIMVTMPYGLYMKLH 235 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 571,521 Number of Sequences: 2352 Number of extensions: 10235 Number of successful extensions: 65 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57188952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -