BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20107 (796 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ493870-1|ABF48723.1| 2458|Homo sapiens acetyl-Coenzyme A carbo... 33 1.6 AJ575592-1|CAE01471.3| 2458|Homo sapiens Acetyl-CoA carboxylase ... 33 1.6 AJ575431-1|CAE01470.2| 1098|Homo sapiens acetyl-CoA carboxylase ... 33 1.6 AY382667-1|AAR37018.1| 2458|Homo sapiens acetyl-CoA carboxylase ... 32 2.7 >DQ493870-1|ABF48723.1| 2458|Homo sapiens acetyl-Coenzyme A carboxylase 2 protein. Length = 2458 Score = 32.7 bits (71), Expect = 1.6 Identities = 22/70 (31%), Positives = 31/70 (44%) Frame = +3 Query: 246 HKGLRDAYSKCSTTPSMKQTQNSLPSYLSNLAPGFAMDPTQSNVKHTDGAIQNDENDLHN 425 HKG +DA + ++ P Q P S+ AP + Q+N T G D N L + Sbjct: 79 HKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPEL---QANGTGTQGLEATDTNGLSS 135 Query: 426 QEAPQSQKVG 455 PQ Q+ G Sbjct: 136 SARPQGQQAG 145 >AJ575592-1|CAE01471.3| 2458|Homo sapiens Acetyl-CoA carboxylase 2 protein. Length = 2458 Score = 32.7 bits (71), Expect = 1.6 Identities = 22/70 (31%), Positives = 31/70 (44%) Frame = +3 Query: 246 HKGLRDAYSKCSTTPSMKQTQNSLPSYLSNLAPGFAMDPTQSNVKHTDGAIQNDENDLHN 425 HKG +DA + ++ P Q P S+ AP + Q+N T G D N L + Sbjct: 79 HKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPEL---QANGTGTQGLEATDTNGLSS 135 Query: 426 QEAPQSQKVG 455 PQ Q+ G Sbjct: 136 SARPQGQQAG 145 >AJ575431-1|CAE01470.2| 1098|Homo sapiens acetyl-CoA carboxylase 2 protein. Length = 1098 Score = 32.7 bits (71), Expect = 1.6 Identities = 22/70 (31%), Positives = 31/70 (44%) Frame = +3 Query: 246 HKGLRDAYSKCSTTPSMKQTQNSLPSYLSNLAPGFAMDPTQSNVKHTDGAIQNDENDLHN 425 HKG +DA + ++ P Q P S+ AP + Q+N T G D N L + Sbjct: 79 HKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPEL---QANGTGTQGLEATDTNGLSS 135 Query: 426 QEAPQSQKVG 455 PQ Q+ G Sbjct: 136 SARPQGQQAG 145 >AY382667-1|AAR37018.1| 2458|Homo sapiens acetyl-CoA carboxylase 2 protein. Length = 2458 Score = 31.9 bits (69), Expect = 2.7 Identities = 22/70 (31%), Positives = 31/70 (44%) Frame = +3 Query: 246 HKGLRDAYSKCSTTPSMKQTQNSLPSYLSNLAPGFAMDPTQSNVKHTDGAIQNDENDLHN 425 HKG +DA + ++ P Q P S+ AP + Q+N T G D N L + Sbjct: 79 HKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPEL---QANGIGTQGLEATDTNGLSS 135 Query: 426 QEAPQSQKVG 455 PQ Q+ G Sbjct: 136 SARPQGQQAG 145 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,105,058 Number of Sequences: 237096 Number of extensions: 1995354 Number of successful extensions: 6405 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6398 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9757565650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -