BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20105 (441 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26390.1 68415.m03167 serpin, putative / serine protease inhi... 33 0.085 At3g45220.1 68416.m04880 serpin, putative / serine protease inhi... 32 0.20 At5g07400.1 68418.m00847 forkhead-associated domain-containing p... 29 1.8 At1g25210.1 68414.m03129 UDP-3-O-acyl N-acetylglycosamine deacet... 27 4.2 At1g25141.1 68414.m03121 UDP-3-0-acyl N-acetylglucosamine deacet... 27 4.2 At1g25054.1 68414.m03117 UDP-3-O-acyl N-acetylglycosamine deacet... 27 4.2 At1g24880.1 68414.m03111 UDP-3-0-acyl N-acetylglucosamine deacet... 27 4.2 At1g24793.1 68414.m03107 UDP-3-0-acyl N-acetylglucosamine deacet... 27 4.2 At1g10120.1 68414.m01141 basic helix-loop-helix (bHLH) family pr... 27 4.2 At5g28482.1 68418.m03463 hypothetical protein similar to At2g066... 27 5.6 At3g60860.1 68416.m06808 guanine nucleotide exchange family prot... 27 5.6 At2g20540.1 68415.m02399 pentatricopeptide (PPR) repeat-containi... 27 5.6 At2g06630.1 68415.m00736 hypothetical protein similar to At2g121... 27 5.6 At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesi... 27 7.4 At2g15490.2 68415.m01773 UDP-glucoronosyl/UDP-glucosyl transfera... 26 9.8 At2g15490.1 68415.m01772 UDP-glucoronosyl/UDP-glucosyl transfera... 26 9.8 At2g15480.1 68415.m01771 UDP-glucoronosyl/UDP-glucosyl transfera... 26 9.8 At1g23420.1 68414.m02934 inner no outer protein (INO) identical ... 26 9.8 >At2g26390.1 68415.m03167 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 389 Score = 33.1 bits (72), Expect = 0.085 Identities = 21/83 (25%), Positives = 36/83 (43%) Frame = +1 Query: 166 NLADDKNVIASPLGVMLLLSLIRVWSRCTVKEEIREILGGGEAQESSHTYGLLNQRYAEF 345 ++A+ NV+ SP+ + +LLSLI S KEEI L + + E Sbjct: 25 DVANGSNVVFSPMSINVLLSLIAAGSNPVTKEEILSFLMSPSTDHLNAVLAKIADGGTER 84 Query: 346 DPKFLTVANKIYVSDQYKLADAF 414 L+ A+ +++ L +F Sbjct: 85 SDLCLSTAHGVWIDKSSYLKPSF 107 >At3g45220.1 68416.m04880 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 393 Score = 31.9 bits (69), Expect = 0.20 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +1 Query: 169 LADDKNVIASPLGVMLLLSLIRVWSRCTVKEEI 267 +A+ N++ SP+ + +LL LI S C KE+I Sbjct: 25 VANGSNLVFSPMSINVLLCLIAAGSNCVTKEQI 57 >At5g07400.1 68418.m00847 forkhead-associated domain-containing protein / FHA domain-containing protein Length = 1084 Score = 28.7 bits (61), Expect = 1.8 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = +1 Query: 178 DKNVIASPLGVMLLLSLIRVWSRCTVKEEIREILG---GGEAQESSHTY 315 D + + P V+ L SLI RCT ++E+LG E+QES Y Sbjct: 746 DMSKLIQPYHVVALCSLIASLQRCTGIWRLQEVLGRYKWPESQESDFVY 794 >At1g25210.1 68414.m03129 UDP-3-O-acyl N-acetylglycosamine deacetylase family protein contains Pfam domain PF03331: UDP-3-O-acyl N-acetylglycosamine deacetylase Length = 955 Score = 27.5 bits (58), Expect = 4.2 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 204 ERRRYHILVVS*VVGFLKNLQGGLVDGIAESCP 106 E RYH +S GF K + G+ + E CP Sbjct: 886 ESARYHTAFISGKDGFFKPVTLGVAPNVGEPCP 918 >At1g25141.1 68414.m03121 UDP-3-0-acyl N-acetylglucosamine deacetylase family protein / F-box protein-related contains weak hit to TIGRFAM TIGR01640 : F-box protein interaction domain and weak hit to Pfam PF00646: F-box domain; Length = 925 Score = 27.5 bits (58), Expect = 4.2 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 204 ERRRYHILVVS*VVGFLKNLQGGLVDGIAESCP 106 E RYH +S GF K + G+ + E CP Sbjct: 856 ESARYHTAFISGKDGFFKPVTLGVAPNVGEPCP 888 >At1g25054.1 68414.m03117 UDP-3-O-acyl N-acetylglycosamine deacetylase family protein contains Pfam domain PF03331: UDP-3-O-acyl N-acetylglycosamine deacetylase Length = 949 Score = 27.5 bits (58), Expect = 4.2 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 204 ERRRYHILVVS*VVGFLKNLQGGLVDGIAESCP 106 E RYH +S GF K + G+ + E CP Sbjct: 880 ESARYHTAFISGKDGFFKPVTLGVAPNVGEPCP 912 >At1g24880.1 68414.m03111 UDP-3-0-acyl N-acetylglucosamine deacetylase family protein / F-box protein-related contains weak hit to TIGRFAM TIGR01640 : F-box protein interaction domain and weak hit to Pfam PF00646: F-box domain; similar to ESTs dbj AV442495.1, gb|BE522756.1, gb|T42945.1, gb|BE525268.1, gb|BE523201.1, gb|BE526298.1, gb|T42945.1, gb|AA651584.1, dbj|AV552951.1, dbj|AV547151.1, dbj|AV563142.1 Length = 905 Score = 27.5 bits (58), Expect = 4.2 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 204 ERRRYHILVVS*VVGFLKNLQGGLVDGIAESCP 106 E RYH +S GF K + G+ + E CP Sbjct: 836 ESARYHTAFISGKDGFFKPVTLGVAPNVGEPCP 868 >At1g24793.1 68414.m03107 UDP-3-0-acyl N-acetylglucosamine deacetylase family protein / F-box protein-related contains weak hit to TIGRFAM TIGR01640 : F-box protein interaction domain and weak hit to Pfam PF00646: F-box domain; similar to ESTs dbj AV442495.1, gb|BE522756.1, gb|T42945.1, gb|BE525268.1, gb|BE523201.1, gb|BE526298.1, gb|T42945.1, gb|AA651584.1, dbj|AV552951.1, dbj|AV547151.1, dbj|AV563142.1 Length = 925 Score = 27.5 bits (58), Expect = 4.2 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 204 ERRRYHILVVS*VVGFLKNLQGGLVDGIAESCP 106 E RYH +S GF K + G+ + E CP Sbjct: 856 ESARYHTAFISGKDGFFKPVTLGVAPNVGEPCP 888 >At1g10120.1 68414.m01141 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 301 Score = 27.5 bits (58), Expect = 4.2 Identities = 15/73 (20%), Positives = 32/73 (43%) Frame = +1 Query: 91 GHEFSRTRLGDAIDKTSLKILKESYNLADDKNVIASPLGVMLLLSLIRVWSRCTVKEEIR 270 GH + G+ + + ++ + ++DD + ASP+G L W++ V+E Sbjct: 42 GHFLGSDKKGERLIRAGESSHEDHHQVSDDAVLGASPVGKRRLPEAESQWNKKAVEEFQE 101 Query: 271 EILGGGEAQESSH 309 + G + + H Sbjct: 102 DPQRGNDQSQKKH 114 >At5g28482.1 68418.m03463 hypothetical protein similar to At2g06630, At2g12120, At1g45090, At2g05470 Length = 231 Score = 27.1 bits (57), Expect = 5.6 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +3 Query: 264 DKGNPWGR--GGSRVITHIRIIKSALRRIRPEI 356 D GNP RV+TH R IK A+ +RP + Sbjct: 87 DAGNPTAMYFEALRVLTHERDIKGAINLLRPHV 119 >At3g60860.1 68416.m06808 guanine nucleotide exchange family protein similar to guanine nucleotide exchange factor, Homo sapiens, GI:5456754; contains Pfam profile PF01369: Sec7 domain Length = 1793 Score = 27.1 bits (57), Expect = 5.6 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = +1 Query: 259 EEIREILGG----GEAQESSHTYGLLNQRYAEFDPKFLTVANKIYV 384 E IR L G GEAQ+ +RY + +PK T A+ YV Sbjct: 698 EAIRTFLEGFRLPGEAQKIDRIMEKFAERYCKCNPKVFTSADSAYV 743 >At2g20540.1 68415.m02399 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 534 Score = 27.1 bits (57), Expect = 5.6 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 273 FPYLFLDCAPAPDSYQGKQQH 211 FP++F CA Y GKQ H Sbjct: 112 FPFMFKSCASLGSCYLGKQVH 132 >At2g06630.1 68415.m00736 hypothetical protein similar to At2g12120, At1g45090, At2g05470, At5g28482 Length = 231 Score = 27.1 bits (57), Expect = 5.6 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +3 Query: 264 DKGNPWGR--GGSRVITHIRIIKSALRRIRPEI 356 D GNP RV+TH R IK A+ +RP + Sbjct: 87 DAGNPTATYFEALRVLTHERDIKGAINLLRPHV 119 >At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesin like protein A, Arabidopsis thaliana, gb:Q07970 Length = 790 Score = 26.6 bits (56), Expect = 7.4 Identities = 17/64 (26%), Positives = 31/64 (48%) Frame = +3 Query: 162 LQPS*RQECDSVSSRRDAAAFLDTSLEPVHSQGRDKGNPWGRGGSRVITHIRIIKSALRR 341 LQ S R+E D V + AA TSLE ++ + ++ + +++ T + + + A R Sbjct: 190 LQVSLREELDKVKEEKMAAKQKVTSLEDMYKRLQEYNTSLQQYNTKLQTDLEVAREAHTR 249 Query: 342 IRPE 353 E Sbjct: 250 AEKE 253 >At2g15490.2 68415.m01773 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 270 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = +1 Query: 202 LGVMLLLSLIRVWSRCTVKEEIREILGGGEAQE 300 +G L+ ++ SR V++ +RE++GG +A+E Sbjct: 201 VGATELVKKGKLISRAQVEKAVREVIGGEKAEE 233 >At2g15490.1 68415.m01772 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 484 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = +1 Query: 202 LGVMLLLSLIRVWSRCTVKEEIREILGGGEAQE 300 +G L+ ++ SR V++ +RE++GG +A+E Sbjct: 415 VGATELVKKGKLISRAQVEKAVREVIGGEKAEE 447 >At2g15480.1 68415.m01771 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 372 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = +1 Query: 202 LGVMLLLSLIRVWSRCTVKEEIREILGGGEAQE 300 +G L+ ++ SR V++ +RE++GG +A+E Sbjct: 303 VGATELVKKGKLISRAQVEKAVREVIGGEKAEE 335 >At1g23420.1 68414.m02934 inner no outer protein (INO) identical to INNER NO OUTER (INO) [Arabidopsis thaliana] GI:6684816 Length = 231 Score = 26.2 bits (55), Expect = 9.8 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = +1 Query: 247 CTVKEEIREILGGGEAQESSHTYGLLNQRYAEFDPKFLTVANKIYVSDQ 393 C +KEEIR + + + L + +A F P NK SDQ Sbjct: 144 CFIKEEIRRLKAQNPSMAHKEAFSLAAKNWAHFPP----AHNKRAASDQ 188 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,746,722 Number of Sequences: 28952 Number of extensions: 195360 Number of successful extensions: 532 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 532 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 702840360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -