BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20104 (748 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z77661-1|CAB01186.1| 341|Caenorhabditis elegans Hypothetical pr... 30 2.0 Z77665-1|CAB01220.1| 339|Caenorhabditis elegans Hypothetical pr... 29 2.6 >Z77661-1|CAB01186.1| 341|Caenorhabditis elegans Hypothetical protein F40G12.1 protein. Length = 341 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/46 (21%), Positives = 28/46 (60%) Frame = -3 Query: 149 VFLIYQ*LSKSHIADFDNSRLISYKCLRLTLYHPVSISIKLIFLEC 12 +F+I + L+ + +++ SR I + L+++HP+ + + +++C Sbjct: 122 IFMIERCLASFFVKNYEKSRKIWVSLMILSIFHPLVFASAIAYIQC 167 >Z77665-1|CAB01220.1| 339|Caenorhabditis elegans Hypothetical protein K02E11.2 protein. Length = 339 Score = 29.5 bits (63), Expect = 2.6 Identities = 10/46 (21%), Positives = 28/46 (60%) Frame = -3 Query: 149 VFLIYQ*LSKSHIADFDNSRLISYKCLRLTLYHPVSISIKLIFLEC 12 +F++ + L+ +A+++ SR I + L+++HP+ + +++C Sbjct: 120 IFMVERCLATFLVANYEKSRKIWVSLIILSIFHPLVFASAFAYIQC 165 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,718,537 Number of Sequences: 27780 Number of extensions: 313561 Number of successful extensions: 568 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 568 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1766990064 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -