BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20103 (781 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 27 0.86 CR954257-6|CAJ14157.1| 375|Anopheles gambiae RrnaAD, ribosomal ... 23 8.0 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 8.0 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 26.6 bits (56), Expect = 0.86 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +2 Query: 218 TSNVRTHGPQYYITHCQYHNRKRSSKNVNSLKNQTLLKKSP 340 TS R H PQ Y Q H + + +KN+T + + P Sbjct: 143 TSTHRHHLPQQYQQQQQQHQLEHNGGREQMMKNETSIDEVP 183 >CR954257-6|CAJ14157.1| 375|Anopheles gambiae RrnaAD, ribosomal RNA adenine dimethylaseprotein. Length = 375 Score = 23.4 bits (48), Expect = 8.0 Identities = 11/20 (55%), Positives = 12/20 (60%), Gaps = 3/20 (15%) Frame = +1 Query: 715 WMLSR---HHSLIDHLLPDN 765 W L R +L DHLLPDN Sbjct: 208 WYLVRIVPRRNLFDHLLPDN 227 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.4 bits (48), Expect = 8.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 361 ECHLDHLGR 335 ECHLDH GR Sbjct: 328 ECHLDHNGR 336 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 829,734 Number of Sequences: 2352 Number of extensions: 16717 Number of successful extensions: 28 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81497388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -