BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20100 (553 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 25 0.44 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 2.3 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 4.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.2 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 9.5 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 25.0 bits (52), Expect = 0.44 Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Frame = +1 Query: 178 DHSVLCCVHRHRASHRRCRQEPGGDDPNNTIFDAKRLI--GRKFEDATVQADMKHWPF 345 DH + +H + SH +QEP G +N F RL+ D + ADM + + Sbjct: 342 DHQAM--LHHNPMSHH-LKQEPSGFTSSNHPFSINRLLPTAESKADIKMYADMHQYGY 396 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.6 bits (46), Expect = 2.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 130 LPAREGGDHRQRPGQQDH 183 +P R+ DHR RP + H Sbjct: 246 IPIRQCDDHRDRPPRHFH 263 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.8 bits (44), Expect = 4.1 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +3 Query: 366 KPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKT 482 KPKI+ + ED+ E+ K K T + L KT Sbjct: 244 KPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTEDEELNKT 282 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -2 Query: 129 TPTQEYVVPRSIPT 88 TPT + VV R+IP+ Sbjct: 15 TPTDQRVVTRTIPS 28 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 20.6 bits (41), Expect = 9.5 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -1 Query: 502 VITAFCTVLPR*ASAVSFIF 443 +ITAF +VLP+ A +++ F Sbjct: 87 LITAFLSVLPQLAWDITYRF 106 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,176 Number of Sequences: 336 Number of extensions: 3202 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13621010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -