BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20095 (724 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0445 - 21316412-21317162,21317253-21317385,21317634-213177... 29 4.9 08_01_0203 + 1639993-1641141 28 8.6 >05_04_0445 - 21316412-21317162,21317253-21317385,21317634-21317721, 21317873-21318238 Length = 445 Score = 28.7 bits (61), Expect = 4.9 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = -3 Query: 716 SVQPGGTTSGPPASLVPY*FKYSPHRTCHIRLPEV**RT---SVSRDISSSLHS 564 SV+PGG G P +VP F+ S T + R+ S SRD SS+ S Sbjct: 273 SVEPGGIVPGQPEQIVPRAFEESFRSTTSFSKSSIMDRSMDFSSSRDFSSARFS 326 >08_01_0203 + 1639993-1641141 Length = 382 Score = 27.9 bits (59), Expect = 8.6 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = -1 Query: 661 DSNIPRIERVISGFLKYSSERLFLVIFPVLSIASAVKTIVHGLVVVNVHACSKL 500 D I ++ +Y ERL L+ +L + AV T+ L + + H C KL Sbjct: 269 DDKAQMIMHLLEAADRYDVERLKLICELMLCKSIAVDTVAATLAMADQHHCQKL 322 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,909,911 Number of Sequences: 37544 Number of extensions: 405631 Number of successful extensions: 878 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 878 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1886372480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -