BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20094 (331 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 25 0.16 U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 21 2.5 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 25.4 bits (53), Expect = 0.16 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +1 Query: 91 PPPPLQNHDSVDEGHSLSRGRGFPSFNEDDEK 186 P P + H+ +RG GFP + D+++ Sbjct: 332 PRPNIDRHEVTRPAAPANRGNGFPKRSSDEQQ 363 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 21.4 bits (43), Expect = 2.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 Query: 160 PSFNEDDEKENGYG 201 PS N+D NGYG Sbjct: 365 PSINDDGTCGNGYG 378 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,965 Number of Sequences: 336 Number of extensions: 1045 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 6367260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -