BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20093 (676 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g26790.2 68417.m03859 GDSL-motif lipase/hydrolase family prot... 31 0.53 At4g26790.1 68417.m03858 GDSL-motif lipase/hydrolase family prot... 31 0.53 >At4g26790.2 68417.m03859 GDSL-motif lipase/hydrolase family protein similar to family II lipase EXL3 (GI:15054386), EXL1 (GI:15054382), EXL2 (GI:15054384) [Arabidopsis thaliana]; contains Pfam profile PF00657: Lipase/Acylhydrolase with GDSL-like motif Length = 351 Score = 31.5 bits (68), Expect = 0.53 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 77 VKYSKRFSTTLKEYFKEGQANAVFVSALYLIH-QTNQIL 190 V+Y K + T L+ Y E +AN + +LYLI TN L Sbjct: 133 VEYYKEYQTRLRSYLGEEKANEIISESLYLISIGTNDFL 171 >At4g26790.1 68417.m03858 GDSL-motif lipase/hydrolase family protein similar to family II lipase EXL3 (GI:15054386), EXL1 (GI:15054382), EXL2 (GI:15054384) [Arabidopsis thaliana]; contains Pfam profile PF00657: Lipase/Acylhydrolase with GDSL-like motif Length = 351 Score = 31.5 bits (68), Expect = 0.53 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 77 VKYSKRFSTTLKEYFKEGQANAVFVSALYLIH-QTNQIL 190 V+Y K + T L+ Y E +AN + +LYLI TN L Sbjct: 133 VEYYKEYQTRLRSYLGEEKANEIISESLYLISIGTNDFL 171 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,579,424 Number of Sequences: 28952 Number of extensions: 223075 Number of successful extensions: 452 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 452 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1432596384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -