BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20092 (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 71 7e-13 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 71 7e-13 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 65 5e-11 At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ... 61 8e-10 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 57 1e-08 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 56 2e-08 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 56 2e-08 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 56 2e-08 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 56 2e-08 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 56 3e-08 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 56 3e-08 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 54 9e-08 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 52 3e-07 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 52 3e-07 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 50 1e-06 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 40 1e-06 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 48 8e-06 At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein... 46 3e-05 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 33 5e-05 At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ... 44 7e-05 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 43 2e-04 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 42 4e-04 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 42 5e-04 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 41 7e-04 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 41 7e-04 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 41 7e-04 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 41 0.001 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 41 0.001 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 41 0.001 At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing ... 40 0.001 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 40 0.001 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 40 0.002 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 40 0.002 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 40 0.002 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 40 0.002 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 40 0.002 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 39 0.003 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 39 0.003 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 39 0.003 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 39 0.004 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 39 0.004 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 39 0.004 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 39 0.004 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 36 0.004 At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ... 38 0.005 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 38 0.006 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 38 0.006 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 38 0.006 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 38 0.008 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 38 0.008 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 38 0.008 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 37 0.011 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 37 0.011 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 37 0.011 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 37 0.011 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 37 0.015 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 36 0.020 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 36 0.020 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 36 0.020 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 36 0.020 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 36 0.026 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 36 0.026 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 36 0.034 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 36 0.034 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 36 0.034 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 36 0.034 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 36 0.034 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 36 0.034 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 36 0.034 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 35 0.045 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 35 0.045 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 35 0.045 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 35 0.045 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 35 0.045 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 35 0.045 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 35 0.045 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 35 0.045 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 35 0.060 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 35 0.060 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 35 0.060 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 35 0.060 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 35 0.060 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 35 0.060 At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ... 35 0.060 At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 34 0.079 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 34 0.079 At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing ... 34 0.10 At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing ... 34 0.10 At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing ... 34 0.10 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 34 0.10 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 33 0.14 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 33 0.14 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 33 0.14 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 33 0.14 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 33 0.14 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 33 0.14 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 33 0.18 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 33 0.18 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 33 0.18 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 33 0.18 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 33 0.18 At5g43960.2 68418.m05378 nuclear transport factor 2 (NTF2) famil... 33 0.24 At5g43960.1 68418.m05379 nuclear transport factor 2 (NTF2) famil... 33 0.24 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 33 0.24 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 33 0.24 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 32 0.32 At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containi... 32 0.32 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 32 0.32 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 32 0.32 At1g72800.1 68414.m08416 nuM1-related contains similarity with n... 32 0.32 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 32 0.32 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 32 0.32 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 32 0.42 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 32 0.42 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 32 0.42 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 32 0.42 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 32 0.42 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 31 0.56 At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing ... 31 0.56 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 31 0.56 At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing ... 31 0.73 At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ... 31 0.73 At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing ... 31 0.97 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 31 0.97 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 31 0.97 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 30 1.3 At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing ... 30 1.3 At3g11400.1 68416.m01390 eukaryotic translation initiation facto... 30 1.3 At2g21690.1 68415.m02580 RNA-binding protein, putative similar t... 30 1.3 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 30 1.7 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 30 1.7 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 30 1.7 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 29 2.2 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 29 2.2 At3g18810.1 68416.m02389 protein kinase family protein contains ... 29 2.2 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 29 2.2 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 29 2.2 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 29 2.2 At3g63450.1 68416.m07144 RNA recognition motif (RRM)-containing ... 29 3.0 At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing ... 29 3.9 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 29 3.9 At3g51950.1 68416.m05698 zinc finger (CCCH-type) family protein ... 29 3.9 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 29 3.9 At2g47390.1 68415.m05915 expressed protein 29 3.9 At2g39260.1 68415.m04821 MIF4G domain-containing protein similar... 29 3.9 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 29 3.9 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 29 3.9 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 29 3.9 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 28 5.2 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 28 5.2 At5g12440.1 68418.m01462 zinc finger (CCCH-type) family protein ... 28 6.8 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 28 6.8 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 28 6.8 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 28 6.8 At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing ... 28 6.8 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 28 6.8 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 28 6.8 At5g44200.1 68418.m05408 nuclear cap-binding protein, putative s... 27 9.0 At5g22830.1 68418.m02669 magnesium transporter CorA-like family ... 27 9.0 At5g19030.3 68418.m02263 RNA recognition motif (RRM)-containing ... 27 9.0 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 27 9.0 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 27 9.0 At5g03580.1 68418.m00316 polyadenylate-binding protein, putative... 27 9.0 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 27 9.0 At2g42890.2 68415.m05312 RNA recognition motif (RRM)-containing ... 27 9.0 At2g42890.1 68415.m05311 RNA recognition motif (RRM)-containing ... 27 9.0 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 27 9.0 At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)... 27 9.0 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 70.9 bits (166), Expect = 7e-13 Identities = 39/96 (40%), Positives = 57/96 (59%), Gaps = 11/96 (11%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA--KA 427 FG YGEI + D +TG+ RGF FI F P +DKV+ H IN K+V+ K+ K Sbjct: 39 FGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVI-EDTHVINGKQVEIKRTIPKG 97 Query: 428 RHG---------KIFVGGLSSEISDDEIRNFFSEFG 508 G KIFVGG+ S +++DE+++FF+++G Sbjct: 98 AGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYG 133 Score = 45.6 bits (103), Expect = 3e-05 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 6/91 (6%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG------EHTINNKKVDPK 415 F YG + V D T RSRGF F++F + E +D++++ G + + KK +PK Sbjct: 129 FAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPK 188 Query: 416 KAKARHGKIFVGGLSSEISDDEIRNFFSEFG 508 K+ R + S+D ++ +G Sbjct: 189 KSLNRSPPSYGSHPRGRSSNDSYASYGGPYG 219 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/51 (41%), Positives = 30/51 (58%) Frame = +1 Query: 535 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 687 D+ Q +GF FITF VV+ +++ I GK+V++KR PK G GG Sbjct: 53 DRHTGQPRGFGFITFADPSVVDKVIE-DTHVINGKQVEIKRTIPK--GAGG 100 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/54 (35%), Positives = 35/54 (64%), Gaps = 1/54 (1%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTPKRTIGGKEVDVKRATPK 669 ++E ++ D N+ +GF F+ F+SE+VV++LL K + +V++K+A PK Sbjct: 135 VVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPK 188 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 70.9 bits (166), Expect = 7e-13 Identities = 39/96 (40%), Positives = 57/96 (59%), Gaps = 11/96 (11%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA--KA 427 FG YGEI + D +TG+ RGF FI F P +DKV+ H IN K+V+ K+ K Sbjct: 39 FGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVI-EDTHVINGKQVEIKRTIPKG 97 Query: 428 RHG---------KIFVGGLSSEISDDEIRNFFSEFG 508 G KIFVGG+ S +++DE+++FF+++G Sbjct: 98 AGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYG 133 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 379 F YG + V D T RSRGF F++F + E +D++++ G Sbjct: 129 FAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKG 170 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/51 (41%), Positives = 30/51 (58%) Frame = +1 Query: 535 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 687 D+ Q +GF FITF VV+ +++ I GK+V++KR PK G GG Sbjct: 53 DRHTGQPRGFGFITFADPSVVDKVIE-DTHVINGKQVEIKRTIPK--GAGG 100 Score = 31.9 bits (69), Expect = 0.42 Identities = 13/33 (39%), Positives = 24/33 (72%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL 609 ++E ++ D N+ +GF F+ F+SE+VV++LL Sbjct: 135 VVEHQVIRDHETNRSRGFGFVIFDSEEVVDELL 167 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 64.9 bits (151), Expect = 5e-11 Identities = 36/94 (38%), Positives = 49/94 (52%), Gaps = 9/94 (9%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 433 FG YGEI + D TG+ RGF F+ + +DKV+ H I K+V+ K+ R Sbjct: 62 FGKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKVI-QDNHIIIGKQVEIKRTIPRG 120 Query: 434 G---------KIFVGGLSSEISDDEIRNFFSEFG 508 KIFVGG+ S + DDE + FF +FG Sbjct: 121 SMSSNDFKTKKIFVGGIPSSVDDDEFKEFFMQFG 154 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/60 (31%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH-TINNKKVDPKKAKAR 430 F +GE++ + D +TGRSRGF F+ +++ + +D ++A G ++ +V+ KKA+ + Sbjct: 150 FMQFGELKEHQIMRDHSTGRSRGFGFVTYESEDMVDHLLAKGNRIELSGTQVEIKKAEPK 209 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Frame = +1 Query: 535 DKTKNQRKGFCFITFESEQVVNDLLKTPKR-TIGGKEVDVKRATPK 669 D + + +GF F+T+ESE +V+ LL R + G +V++K+A PK Sbjct: 164 DHSTGRSRGFGFVTYESEDMVDHLLAKGNRIELSGTQVEIKKAEPK 209 Score = 34.3 bits (75), Expect = 0.079 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = +1 Query: 535 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 669 D+ Q +GF F+T+ VV+ +++ I GK+V++KR P+ Sbjct: 76 DRKTGQPRGFGFVTYADSSVVDKVIQ-DNHIIIGKQVEIKRTIPR 119 Score = 31.1 bits (67), Expect = 0.73 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +3 Query: 93 QDITTDNQLNGNAENGGGDSQDHNSAXAPGRDDDRKLFVGGLSWETTDKELRDH 254 +D D + + + E+ SQ H+ G D K+FVGGL+ ETT E H Sbjct: 11 EDEIHDPKPSEDIEDDDDKSQPHSGG---GVDSAGKIFVGGLARETTSAEFLKH 61 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 434 GKIFVGGLSSEISDDEIRNFFSEFG 508 GKIFVGGL+ E + E F ++G Sbjct: 42 GKIFVGGLARETTSAEFLKHFGKYG 66 >At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing protein similar to GB:L02953 from [Xenopus laevis] (Nucleic Acids Res. 21, 999-1006 (1993)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 369 Score = 60.9 bits (141), Expect = 8e-10 Identities = 35/97 (36%), Positives = 53/97 (54%), Gaps = 12/97 (12%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPK------ 415 FG +GE+ + TD TG RGF F+ F +KV+ +H I+++KVD K Sbjct: 86 FGKFGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKVLEE-DHVIDDRKVDLKRTLPRG 144 Query: 416 ------KAKARHGKIFVGGLSSEISDDEIRNFFSEFG 508 KA ++ KIFVGGL + +DE++N+F +G Sbjct: 145 DKDTDIKAVSKTRKIFVGGLPPLLEEDELKNYFCVYG 181 Score = 51.6 bits (118), Expect = 5e-07 Identities = 22/60 (36%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPKKAKAR 430 F YG+I + D +TGRSRGF F+ F+ +S+D++ + G+ H + +K+V+ K+A+ + Sbjct: 177 FCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKRAEPK 236 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDG 678 I+E ++ +D + +GF F+TF++E V+ L K +G K+V++KRA PK G Sbjct: 183 IIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKRAEPKRTG 239 Score = 32.7 bits (71), Expect = 0.24 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 5/49 (10%) Frame = +3 Query: 102 TTDNQLNGNA--ENGG---GDSQDHNSAXAPGRDDDRKLFVGGLSWETT 233 T D++ NG A + GG S DH + + KLFVGG+SWETT Sbjct: 31 TFDDRRNGGAAVDTGGIQMKHSVDHRHSSS-SMSSPGKLFVGGVSWETT 78 Score = 31.5 bits (68), Expect = 0.56 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 434 GKIFVGGLSSEISDDEIRNFFSEFG 508 GK+FVGG+S E + + N+F +FG Sbjct: 66 GKLFVGGVSWETTAETFANYFGKFG 90 Score = 31.1 bits (67), Expect = 0.73 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 535 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 675 D+ +GF F+TF V +L+ I ++VD+KR P+ D Sbjct: 100 DRITGNPRGFGFVTFADSAVAEKVLE-EDHVIDDRKVDLKRTLPRGD 145 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 57.2 bits (132), Expect = 1e-08 Identities = 40/113 (35%), Positives = 56/113 (49%), Gaps = 28/113 (24%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR- 430 FG YG++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 35 FGKYGDLVEAVIMRDRTTGRARGFGFIVFADPSVAERVI-MDKHIIDGRTVEAKKAVPRD 93 Query: 431 ------------------HG---------KIFVGGLSSEISDDEIRNFFSEFG 508 HG KIFVGGL S I++ E +N+F +FG Sbjct: 94 DQQVLKRHASPMHLISPSHGGNGGGARTKKIFVGGLPSSITEAEFKNYFDQFG 146 Score = 50.0 bits (114), Expect = 1e-06 Identities = 24/56 (42%), Positives = 32/56 (57%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 421 F +G I + V D NT R RGF FI F + ES+D V+ H +N K V+ K+A Sbjct: 142 FDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVEVKRA 197 Score = 47.2 bits (107), Expect = 1e-05 Identities = 23/54 (42%), Positives = 34/54 (62%) Frame = +1 Query: 508 TILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 669 TI +V + +D + +GF FITF+SE+ V+ +L + GK V+VKRA PK Sbjct: 147 TIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVEVKRAVPK 200 Score = 34.7 bits (76), Expect = 0.060 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 675 ++E + D+T + +GF FI F V ++ K I G+ V+ K+A P+ D Sbjct: 41 LVEAVIMRDRTTGRARGFGFIVFADPSVAERVI-MDKHIIDGRTVEAKKAVPRDD 94 Score = 30.3 bits (65), Expect = 1.3 Identities = 9/19 (47%), Positives = 17/19 (89%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDH 254 KLF+GG+SW+T ++ L+++ Sbjct: 16 KLFIGGISWDTDEERLQEY 34 Score = 29.9 bits (64), Expect = 1.7 Identities = 8/25 (32%), Positives = 19/25 (76%) Frame = +2 Query: 434 GKIFVGGLSSEISDDEIRNFFSEFG 508 GK+F+GG+S + ++ ++ +F ++G Sbjct: 15 GKLFIGGISWDTDEERLQEYFGKYG 39 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 56.0 bits (129), Expect = 2e-08 Identities = 39/110 (35%), Positives = 56/110 (50%), Gaps = 25/110 (22%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR- 430 F YG++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 26 FSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI-MDKHIIDGRTVEAKKAVPRD 84 Query: 431 ------------------HG------KIFVGGLSSEISDDEIRNFFSEFG 508 HG KIFVGGL S I+++E +N+F +FG Sbjct: 85 DQQVLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFG 134 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/56 (39%), Positives = 33/56 (58%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 421 F +G I + V D NT R RGF FI F + +++D+V+ H +N K V+ K+A Sbjct: 130 FDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 47.2 bits (107), Expect = 1e-05 Identities = 23/58 (39%), Positives = 34/58 (58%) Frame = +1 Query: 508 TILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 681 TI +V + +D + +GF FITF+S+ V+ +L + GK V+VKRA PK P Sbjct: 135 TIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPKEISP 192 Score = 33.9 bits (74), Expect = 0.10 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDHLEH 263 KLF+GG+SW+T ++ LRD+ + Sbjct: 7 KLFIGGISWDTDEERLRDYFSN 28 Score = 33.1 bits (72), Expect = 0.18 Identities = 10/25 (40%), Positives = 20/25 (80%) Frame = +2 Query: 434 GKIFVGGLSSEISDDEIRNFFSEFG 508 GK+F+GG+S + ++ +R++FS +G Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYG 30 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 56.0 bits (129), Expect = 2e-08 Identities = 39/110 (35%), Positives = 56/110 (50%), Gaps = 25/110 (22%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR- 430 F YG++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 26 FSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI-MDKHIIDGRTVEAKKAVPRD 84 Query: 431 ------------------HG------KIFVGGLSSEISDDEIRNFFSEFG 508 HG KIFVGGL S I+++E +N+F +FG Sbjct: 85 DQQVLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFG 134 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/56 (39%), Positives = 33/56 (58%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 421 F +G I + V D NT R RGF FI F + +++D+V+ H +N K V+ K+A Sbjct: 130 FDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 47.2 bits (107), Expect = 1e-05 Identities = 23/58 (39%), Positives = 34/58 (58%) Frame = +1 Query: 508 TILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 681 TI +V + +D + +GF FITF+S+ V+ +L + GK V+VKRA PK P Sbjct: 135 TIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPKEISP 192 Score = 33.9 bits (74), Expect = 0.10 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDHLEH 263 KLF+GG+SW+T ++ LRD+ + Sbjct: 7 KLFIGGISWDTDEERLRDYFSN 28 Score = 33.1 bits (72), Expect = 0.18 Identities = 10/25 (40%), Positives = 20/25 (80%) Frame = +2 Query: 434 GKIFVGGLSSEISDDEIRNFFSEFG 508 GK+F+GG+S + ++ +R++FS +G Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYG 30 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 56.0 bits (129), Expect = 2e-08 Identities = 39/110 (35%), Positives = 56/110 (50%), Gaps = 25/110 (22%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR- 430 F YG++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 26 FSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI-MDKHIIDGRTVEAKKAVPRD 84 Query: 431 ------------------HG------KIFVGGLSSEISDDEIRNFFSEFG 508 HG KIFVGGL S I+++E +N+F +FG Sbjct: 85 DQQVLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFG 134 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/56 (39%), Positives = 33/56 (58%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 421 F +G I + V D NT R RGF FI F + +++D+V+ H +N K V+ K+A Sbjct: 130 FDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 47.2 bits (107), Expect = 1e-05 Identities = 23/58 (39%), Positives = 34/58 (58%) Frame = +1 Query: 508 TILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 681 TI +V + +D + +GF FITF+S+ V+ +L + GK V+VKRA PK P Sbjct: 135 TIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPKEISP 192 Score = 33.9 bits (74), Expect = 0.10 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDHLEH 263 KLF+GG+SW+T ++ LRD+ + Sbjct: 7 KLFIGGISWDTDEERLRDYFSN 28 Score = 33.1 bits (72), Expect = 0.18 Identities = 10/25 (40%), Positives = 20/25 (80%) Frame = +2 Query: 434 GKIFVGGLSSEISDDEIRNFFSEFG 508 GK+F+GG+S + ++ +R++FS +G Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYG 30 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 56.0 bits (129), Expect = 2e-08 Identities = 36/110 (32%), Positives = 54/110 (49%), Gaps = 25/110 (22%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 433 F YGE+ V D TGR RGF F++F P +D+V+ +H+I+ ++VD K+A +R Sbjct: 26 FTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRVLQE-KHSIDTREVDVKRAMSRE 84 Query: 434 -------------------------GKIFVGGLSSEISDDEIRNFFSEFG 508 KIFVGGL ++D+E R +F +G Sbjct: 85 EQQVSGRTGNLNTSRSSGGDAYNKTKKIFVGGLPPTLTDEEFRQYFEVYG 134 Score = 55.2 bits (127), Expect = 4e-08 Identities = 23/59 (38%), Positives = 38/59 (64%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 687 + +V + +D+ N+ +GF F++F+SE V+ +L + GK+V+VKRA PK PGG Sbjct: 136 VTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVEVKRALPKDANPGG 194 Score = 46.0 bits (104), Expect = 2e-05 Identities = 21/69 (30%), Positives = 36/69 (52%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 433 F YG + + + D T R RGF F+ F + +++D V+ H ++ K+V+ K+A + Sbjct: 130 FEVYGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVEVKRALPKD 189 Query: 434 GKIFVGGLS 460 GG S Sbjct: 190 ANPGGGGRS 198 Score = 37.1 bits (82), Expect = 0.011 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = +3 Query: 189 DDRKLFVGGLSWETTDKELRDH 254 D KLFVGG+SWET + +LR+H Sbjct: 4 DQGKLFVGGISWETDEDKLREH 25 Score = 33.5 bits (73), Expect = 0.14 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +2 Query: 434 GKIFVGGLSSEISDDEIRNFFSEFG 508 GK+FVGG+S E +D++R F+ +G Sbjct: 6 GKLFVGGISWETDEDKLREHFTNYG 30 Score = 33.5 bits (73), Expect = 0.14 Identities = 17/47 (36%), Positives = 28/47 (59%) Frame = +1 Query: 535 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 675 DK + +GF F+ F V++ +L+ K +I +EVDVKRA + + Sbjct: 40 DKLTGRPRGFGFVIFSDPSVLDRVLQE-KHSIDTREVDVKRAMSREE 85 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 144 GDSQDHNSAXAPGRDDDRKLFVGGLSWETTDKELRDHLE 260 G+ S+ + +K+FVGGL TD+E R + E Sbjct: 93 GNLNTSRSSGGDAYNKTKKIFVGGLPPTLTDEEFRQYFE 131 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 55.6 bits (128), Expect = 3e-08 Identities = 35/107 (32%), Positives = 56/107 (52%), Gaps = 21/107 (19%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 433 F ++GE+ + D TGR+RGF F+VF P ++V+ +H I+ K V+ KKA R Sbjct: 26 FHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLL-KHIIDGKIVEAKKAVPRD 84 Query: 434 G---------------------KIFVGGLSSEISDDEIRNFFSEFGL 511 KIFVGGL+S +++ E + +F++FG+ Sbjct: 85 DHVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQFGM 131 Score = 45.6 bits (103), Expect = 3e-05 Identities = 22/56 (39%), Positives = 31/56 (55%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 421 F +G I + V D T R RGF FI + + E++DKV+ H +N K V+ K A Sbjct: 126 FAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 181 Score = 41.5 bits (93), Expect = 5e-04 Identities = 19/53 (35%), Positives = 33/53 (62%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 669 I +V + +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 132 ITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 184 Score = 34.7 bits (76), Expect = 0.060 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDH 254 KLF+GG+SWET++ LRD+ Sbjct: 7 KLFIGGISWETSEDRLRDY 25 Score = 34.3 bits (75), Expect = 0.079 Identities = 12/24 (50%), Positives = 19/24 (79%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 K+F+GG+S E S+D +R++F FG Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFG 30 Score = 33.5 bits (73), Expect = 0.14 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 675 +LE + D+ + +GF F+ F V ++ K I GK V+ K+A P+ D Sbjct: 32 VLEAVIMKDRATGRARGFGFVVFADPNVAERVVLL-KHIIDGKIVEAKKAVPRDD 85 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +3 Query: 174 APGRDDDRKLFVGGLSWETTDKELRDH 254 +PG + +K+FVGGL+ T+ E + + Sbjct: 99 SPGPSNSKKIFVGGLASSVTEAEFKKY 125 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 55.6 bits (128), Expect = 3e-08 Identities = 35/107 (32%), Positives = 56/107 (52%), Gaps = 21/107 (19%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 433 F ++GE+ + D TGR+RGF F+VF P ++V+ +H I+ K V+ KKA R Sbjct: 26 FHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLL-KHIIDGKIVEAKKAVPRD 84 Query: 434 G---------------------KIFVGGLSSEISDDEIRNFFSEFGL 511 KIFVGGL+S +++ E + +F++FG+ Sbjct: 85 DHVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQFGM 131 Score = 45.6 bits (103), Expect = 3e-05 Identities = 22/56 (39%), Positives = 31/56 (55%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 421 F +G I + V D T R RGF FI + + E++DKV+ H +N K V+ K A Sbjct: 126 FAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 181 Score = 41.5 bits (93), Expect = 5e-04 Identities = 19/53 (35%), Positives = 33/53 (62%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 669 I +V + +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 132 ITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 184 Score = 34.7 bits (76), Expect = 0.060 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDH 254 KLF+GG+SWET++ LRD+ Sbjct: 7 KLFIGGISWETSEDRLRDY 25 Score = 34.3 bits (75), Expect = 0.079 Identities = 12/24 (50%), Positives = 19/24 (79%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 K+F+GG+S E S+D +R++F FG Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFG 30 Score = 33.5 bits (73), Expect = 0.14 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 675 +LE + D+ + +GF F+ F V ++ K I GK V+ K+A P+ D Sbjct: 32 VLEAVIMKDRATGRARGFGFVVFADPNVAERVVLL-KHIIDGKIVEAKKAVPRDD 85 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +3 Query: 174 APGRDDDRKLFVGGLSWETTDKELRDH 254 +PG + +K+FVGGL+ T+ E + + Sbjct: 99 SPGPSNSKKIFVGGLASSVTEAEFKKY 125 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 54.0 bits (124), Expect = 9e-08 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 25/110 (22%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 433 F +GE+ + V + TGR RGF F+ F P ID+V+ +H I+N+ VD K+A +R Sbjct: 26 FSNFGEVLQVTVMREKATGRPRGFGFVAFSDPAVIDRVL-QDKHHIDNRDVDVKRAMSRE 84 Query: 434 -------------------------GKIFVGGLSSEISDDEIRNFFSEFG 508 KIFVGGL ++ DE R +F +G Sbjct: 85 EQSPAGRSGTFNASRNFDSGANVRTKKIFVGGLPPALTSDEFRAYFETYG 134 Score = 46.4 bits (105), Expect = 2e-05 Identities = 21/50 (42%), Positives = 32/50 (64%) Frame = +1 Query: 535 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 684 D+T + +GF F++F+SE V+ +L + GK+V+VKRA PK PG Sbjct: 144 DQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDLNGKQVEVKRALPKDANPG 193 Score = 46.0 bits (104), Expect = 2e-05 Identities = 20/56 (35%), Positives = 31/56 (55%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 421 F YG + + D T R RGF F+ F + +S+D V+ H +N K+V+ K+A Sbjct: 130 FETYGPVSDAVIMIDQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDLNGKQVEVKRA 185 Score = 35.5 bits (78), Expect = 0.034 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD-GPGG 687 +L+V + +K + +GF F+ F V++ +L+ K I ++VDVKRA + + P G Sbjct: 32 VLQVTVMREKATGRPRGFGFVAFSDPAVIDRVLQD-KHHIDNRDVDVKRAMSREEQSPAG 90 Score = 32.3 bits (70), Expect = 0.32 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +3 Query: 189 DDRKLFVGGLSWETTDKELRDHLEH 263 D KLF+GG+SW+T + LR++ + Sbjct: 4 DQGKLFIGGISWDTDENLLREYFSN 28 Score = 32.3 bits (70), Expect = 0.32 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = +2 Query: 434 GKIFVGGLSSEISDDEIRNFFSEFG 508 GK+F+GG+S + ++ +R +FS FG Sbjct: 6 GKLFIGGISWDTDENLLREYFSNFG 30 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 52.4 bits (120), Expect = 3e-07 Identities = 32/108 (29%), Positives = 54/108 (50%), Gaps = 23/108 (21%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA---- 421 F ++GE+ + D TGR+RGF F+VF P ++ +++ +H I+ + V+ KKA Sbjct: 26 FSSFGEVIEAVILKDRTTGRARGFGFVVFADP-AVAEIVITEKHNIDGRLVEAKKAVPRD 84 Query: 422 -------------------KARHGKIFVGGLSSEISDDEIRNFFSEFG 508 R KIFVGGL S +++ + + +F +FG Sbjct: 85 DQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQFG 132 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/62 (38%), Positives = 35/62 (56%) Frame = +1 Query: 508 TILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 687 T +V + +D + +GF FIT++SE+ V +L + GK V+VKRA PK PG Sbjct: 133 TTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPKELSPGP 192 Query: 688 IR 693 R Sbjct: 193 SR 194 Score = 37.9 bits (84), Expect = 0.006 Identities = 17/55 (30%), Positives = 33/55 (60%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 675 ++E + D+T + +GF F+ F ++ V +++ T K I G+ V+ K+A P+ D Sbjct: 32 VIEAVILKDRTTGRARGFGFVVF-ADPAVAEIVITEKHNIDGRLVEAKKAVPRDD 85 Score = 33.5 bits (73), Expect = 0.14 Identities = 10/24 (41%), Positives = 20/24 (83%) Frame = +3 Query: 183 RDDDRKLFVGGLSWETTDKELRDH 254 + D+ KLF+GG+SW+T ++ L+++ Sbjct: 2 QSDNGKLFIGGISWDTNEERLKEY 25 Score = 33.5 bits (73), Expect = 0.14 Identities = 10/26 (38%), Positives = 21/26 (80%) Frame = +2 Query: 431 HGKIFVGGLSSEISDDEIRNFFSEFG 508 +GK+F+GG+S + +++ ++ +FS FG Sbjct: 5 NGKLFIGGISWDTNEERLKEYFSSFG 30 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 126 NAENGGGDSQDHNSAXAPGRDDDRKLFVGGLSWETTDKELRDHLE 260 N N S S PGR RK+FVGGL T+ + + + E Sbjct: 87 NMVNRSNSSSIQGSPGGPGRT--RKIFVGGLPSSVTESDFKTYFE 129 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 52.4 bits (120), Expect = 3e-07 Identities = 32/108 (29%), Positives = 54/108 (50%), Gaps = 23/108 (21%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA---- 421 F ++GE+ + D TGR+RGF F+VF P ++ +++ +H I+ + V+ KKA Sbjct: 26 FSSFGEVIEAVILKDRTTGRARGFGFVVFADP-AVAEIVITEKHNIDGRLVEAKKAVPRD 84 Query: 422 -------------------KARHGKIFVGGLSSEISDDEIRNFFSEFG 508 R KIFVGGL S +++ + + +F +FG Sbjct: 85 DQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQFG 132 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/62 (38%), Positives = 35/62 (56%) Frame = +1 Query: 508 TILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 687 T +V + +D + +GF FIT++SE+ V +L + GK V+VKRA PK PG Sbjct: 133 TTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPKELSPGP 192 Query: 688 IR 693 R Sbjct: 193 SR 194 Score = 37.9 bits (84), Expect = 0.006 Identities = 17/55 (30%), Positives = 33/55 (60%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 675 ++E + D+T + +GF F+ F ++ V +++ T K I G+ V+ K+A P+ D Sbjct: 32 VIEAVILKDRTTGRARGFGFVVF-ADPAVAEIVITEKHNIDGRLVEAKKAVPRDD 85 Score = 33.5 bits (73), Expect = 0.14 Identities = 10/24 (41%), Positives = 20/24 (83%) Frame = +3 Query: 183 RDDDRKLFVGGLSWETTDKELRDH 254 + D+ KLF+GG+SW+T ++ L+++ Sbjct: 2 QSDNGKLFIGGISWDTNEERLKEY 25 Score = 33.5 bits (73), Expect = 0.14 Identities = 10/26 (38%), Positives = 21/26 (80%) Frame = +2 Query: 431 HGKIFVGGLSSEISDDEIRNFFSEFG 508 +GK+F+GG+S + +++ ++ +FS FG Sbjct: 5 NGKLFIGGISWDTNEERLKEYFSSFG 30 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 126 NAENGGGDSQDHNSAXAPGRDDDRKLFVGGLSWETTDKELRDHLE 260 N N S S PGR RK+FVGGL T+ + + + E Sbjct: 87 NMVNRSNSSSIQGSPGGPGRT--RKIFVGGLPSSVTESDFKTYFE 129 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 50.4 bits (115), Expect = 1e-06 Identities = 27/91 (29%), Positives = 47/91 (51%), Gaps = 9/91 (9%) Frame = +2 Query: 263 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH--- 433 +G++E V D +TGRSRGF ++ F + E + GEH + N+ ++ K A + Sbjct: 26 FGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNAL-KGEHFLGNRILEVKVATPKEEMR 84 Query: 434 ------GKIFVGGLSSEISDDEIRNFFSEFG 508 +IFV + S +S+ + R+ F +G Sbjct: 85 QPAKKVTRIFVARIPSSVSESDFRSHFERYG 115 Score = 44.4 bits (100), Expect = 7e-05 Identities = 24/55 (43%), Positives = 30/55 (54%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 675 I ++ MP D Q +G FITF S V DL++ +GG V V RATPK D Sbjct: 117 ITDLYMPKDYNSKQHRGIGFITFSSADSVEDLME-DTHDLGGTTVAVDRATPKED 170 Score = 33.1 bits (72), Expect = 0.18 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 406 FG +G I+ + DP RGF F+ F D+V A H I ++V Sbjct: 260 FGRFGHIQDAYIPKDPKRSGHRGFGFVTFAENGVADRV-ARRSHEICGQEV 309 Score = 32.3 bits (70), Expect = 0.32 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = +1 Query: 535 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 675 D++ + +GF ++TF S + + LK + +G + ++VK ATPK + Sbjct: 37 DRSTGRSRGFGYVTFASAEDAKNALK-GEHFLGNRILEVKVATPKEE 82 Score = 32.3 bits (70), Expect = 0.32 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD-GP 681 I + +P D ++ +GF F+TF +E V D + I G+EV + ATP + GP Sbjct: 266 IQDAYIPKDPKRSGHRGFGFVTF-AENGVADRVARRSHEICGQEVAIDSATPLDEAGP 322 Score = 31.5 bits (68), Expect = 0.56 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 KIFVG L E S D++R++F FG Sbjct: 241 KIFVGRLPQEASVDDLRDYFGRFG 264 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/51 (35%), Positives = 31/51 (60%) Frame = +1 Query: 517 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 669 +V + D N+ +GF F+T++SE V ++++ + K V+VKRA PK Sbjct: 148 DVVVMHDGVTNRPRGFGFVTYDSEDSVEVVMQSNFHELSDKRVEVKRAIPK 198 Score = 35.5 bits (78), Expect(2) = 1e-06 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +2 Query: 425 ARHGKIFVGGLSSEISDDEIRNFFSEFG 508 +R KIFVGGLSS +++E +++F FG Sbjct: 117 SRTKKIFVGGLSSNTTEEEFKSYFERFG 144 Score = 34.3 bits (75), Expect(2) = 1e-06 Identities = 20/60 (33%), Positives = 28/60 (46%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 433 F YG + V + TG+ RGF F+ F + K + H I K VD +KA +H Sbjct: 26 FSRYGAVLEAVVAKEKVTGKPRGFGFVRFANDCDVVKAL-RDTHFILGKPVDVRKAIRKH 84 Score = 31.9 bits (69), Expect = 0.42 Identities = 10/24 (41%), Positives = 19/24 (79%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 K+FVGG++ E S++ ++ +FS +G Sbjct: 7 KLFVGGIAKETSEEALKQYFSRYG 30 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +3 Query: 195 RKLFVGGLSWETTDKELRDHLE 260 +K+FVGGLS TT++E + + E Sbjct: 120 KKIFVGGLSSNTTEEEFKSYFE 141 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 47.6 bits (108), Expect = 8e-06 Identities = 29/100 (29%), Positives = 50/100 (50%), Gaps = 12/100 (12%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM-AAGEHTINNKKV------- 406 +F A+G I S V DP+ G+S+G+ F+ + E+ + +N+K+V Sbjct: 152 TFSAFGPILSCKVAVDPS-GQSKGYGFVQYDTDEAAQGAIDKLNGMLLNDKQVYVGPFVH 210 Query: 407 ----DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGLS 514 DP K + ++V LS +SD+E+ F EFG++ Sbjct: 211 KLQRDPSGEKVKFTNVYVKNLSESLSDEELNKVFGEFGVT 250 Score = 37.5 bits (83), Expect = 0.008 Identities = 23/94 (24%), Positives = 40/94 (42%), Gaps = 8/94 (8%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM-AAGEHTINNKKV------- 406 +F G++ S+ V D T RS G+ ++ + P+ + + +N + + Sbjct: 64 AFTQAGQVVSVRVCRDMTTRRSLGYGYVNYATPQDASRALNELNFMALNGRAIRVMYSVR 123 Query: 407 DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 508 DP K+ G IF+ L I + FS FG Sbjct: 124 DPSLRKSGVGNIFIKNLDKSIDHKALHETFSAFG 157 Score = 31.5 bits (68), Expect = 0.56 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 370 F +G I S V DP+ G SRG F+ F PE + + Sbjct: 347 FAPFGTITSCKVMRDPS-GVSRGSGFVAFSTPEEATRAI 384 >At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 358 Score = 45.6 bits (103), Expect = 3e-05 Identities = 22/56 (39%), Positives = 31/56 (55%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 421 F +G I + V D T R RGF FI + + E++DKV+ H +N K V+ K A Sbjct: 53 FAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 108 Score = 41.5 bits (93), Expect = 5e-04 Identities = 19/53 (35%), Positives = 33/53 (62%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 669 I +V + +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 59 ITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 111 Score = 36.7 bits (81), Expect = 0.015 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 3/53 (5%) Frame = +2 Query: 362 KVMAAGEHTINNKK---VDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGL 511 K + +H + NK + + KIFVGGL+S +++ E + +F++FG+ Sbjct: 6 KAVPRDDHVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQFGM 58 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +3 Query: 174 APGRDDDRKLFVGGLSWETTDKELRDH 254 +PG + +K+FVGGL+ T+ E + + Sbjct: 26 SPGPSNSKKIFVGGLASSVTEAEFKKY 52 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 33.1 bits (72), Expect(2) = 5e-05 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +2 Query: 353 SIDKVMAAGEHTINNKKV--DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 508 S V+ AG H N ++ + IFVGG+ ++ D+++R FS+FG Sbjct: 292 SSQAVILAGGHGSNGSMGYGSQSDGESTNATIFVGGIDPDVIDEDLRQPFSQFG 345 Score = 31.1 bits (67), Expect(2) = 5e-05 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 263 YGEIESINVKTDPNTGRSRGFAFIVF 340 Y ++S V D NTGRS+G+ F+ F Sbjct: 226 YPSVKSAKVVIDSNTGRSKGYGFVRF 251 >At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 613 Score = 44.4 bits (100), Expect = 7e-05 Identities = 21/63 (33%), Positives = 35/63 (55%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 430 +F +YGEIE +V D +TGR +G+ F++FK + + + E + N+ V A + Sbjct: 427 AFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAREALKRPEKRMYNRIVVCNLASEK 486 Query: 431 HGK 439 GK Sbjct: 487 PGK 489 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/60 (31%), Positives = 29/60 (48%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 430 +F YGE+ + D TGRSRGFAF+ F + E M ++ +++ A R Sbjct: 53 AFSKYGEVVDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQLDGQDLHGRRIRVNYATER 112 Score = 35.9 bits (79), Expect = 0.026 Identities = 14/59 (23%), Positives = 33/59 (55%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 687 +++ ++ D+ + +GF F+TF S + ++ ++ + + G+ + V AT + G GG Sbjct: 60 VVDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQLDGQDLHGRRIRVNYATERGSGFGG 118 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 41.9 bits (94), Expect = 4e-04 Identities = 33/101 (32%), Positives = 50/101 (49%), Gaps = 14/101 (13%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES----IDKV--MAAGE------HTIN 394 +F ++G I S V D TGRS+G+ F+ F+ ES IDK+ M + H I Sbjct: 155 TFSSFGTILSCKVAMDV-TGRSKGYGFVQFEKEESAQAAIDKLNGMLMNDKQVFVGHFIR 213 Query: 395 NKKV--DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGL 511 ++ D R ++V L EI +DE+R F +FG+ Sbjct: 214 RQERARDENTPTPRFTNVYVKNLPKEIGEDELRKTFGKFGV 254 Score = 33.9 bits (74), Expect = 0.10 Identities = 27/93 (29%), Positives = 38/93 (40%), Gaps = 8/93 (8%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT--------INNKKVD 409 F + S+ V D N RS G+A+I F P + M A +T I D Sbjct: 69 FKHVANVVSVRVCRDQNR-RSLGYAYINFSNPNDAYRAMEALNYTPLFDRPIRIMLSNRD 127 Query: 410 PKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 508 P + G IF+ L + I + + FS FG Sbjct: 128 PSTRLSGKGNIFIKNLDASIDNKALFETFSSFG 160 Score = 31.9 bits (69), Expect = 0.42 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 352 F YG + S V +P G SRGF F+ + PE Sbjct: 352 FSEYGNVTSSKVMLNPQ-GMSRGFGFVAYSNPE 383 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 41.5 bits (93), Expect = 5e-04 Identities = 19/52 (36%), Positives = 29/52 (55%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 409 F YGEI V D NTGRS+G+ F+ F+ PE+ + A I+ ++ + Sbjct: 44 FEQYGEILEAVVIADKNTGRSKGYGFVTFRDPEAARRACADPTPIIDGRRAN 95 Score = 34.3 bits (75), Expect = 0.079 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDHLE 260 K+FVGGL+WET + LR H E Sbjct: 25 KVFVGGLAWETQSETLRQHFE 45 Score = 29.5 bits (63), Expect = 2.2 Identities = 17/60 (28%), Positives = 26/60 (43%), Gaps = 3/60 (5%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKPDGP 681 ILE + DK + KG+ F+TF + P I G+ + A+ P+P P Sbjct: 50 ILEAVVIADKNTGRSKGYGFVTFRDPEAARRACADPTPIIDGRRANCNLASLGRPRPPLP 109 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 K+FVGGL+ E + +R F ++G Sbjct: 25 KVFVGGLAWETQSETLRQHFEQYG 48 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 41.1 bits (92), Expect = 7e-04 Identities = 24/93 (25%), Positives = 47/93 (50%), Gaps = 8/93 (8%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--------GEHTINNKKVD 409 F + ++ +N+ D T SRG F++ + E DK++ A G +++ K Sbjct: 38 FQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLVNACHNKKTLPGANSLLQVKYA 97 Query: 410 PKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 508 + + K+FVG L +S+ E+++ FS++G Sbjct: 98 DGELERLEHKLFVGMLPKNVSEAEVQSLFSKYG 130 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 41.1 bits (92), Expect = 7e-04 Identities = 24/93 (25%), Positives = 47/93 (50%), Gaps = 8/93 (8%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--------GEHTINNKKVD 409 F + ++ +N+ D T SRG F++ + E DK++ A G +++ K Sbjct: 38 FQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLVNACHNKKTLPGANSLLQVKYA 97 Query: 410 PKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 508 + + K+FVG L +S+ E+++ FS++G Sbjct: 98 DGELERLEHKLFVGMLPKNVSEAEVQSLFSKYG 130 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/34 (50%), Positives = 23/34 (67%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 355 F YG+I V TD NTGRS+G+ F+ F+ PE+ Sbjct: 44 FDQYGDILEAVVITDKNTGRSKGYGFVTFRDPEA 77 Score = 32.3 bits (70), Expect = 0.32 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDHLE 260 K+FVGGL+WET + LR H + Sbjct: 25 KVFVGGLAWETQSETLRRHFD 45 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 K+FVGGL+ E + +R F ++G Sbjct: 25 KVFVGGLAWETQSETLRRHFDQYG 48 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT 663 ILE + DK + KG+ F+TF + P I G+ + A+ Sbjct: 50 ILEAVVITDKNTGRSKGYGFVTFRDPEAARRACVDPTPIIDGRRANCNLAS 100 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 40.7 bits (91), Expect = 0.001 Identities = 29/105 (27%), Positives = 47/105 (44%), Gaps = 19/105 (18%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-------- 406 +F YGEIE D +G+S+G+ FI+FK+ + + I + Sbjct: 147 AFKQYGEIEDCKCVVDKVSGQSKGYGFILFKSRSGARNALKQPQKKIGTRMTACQLASIG 206 Query: 407 ----DPKKAKARH-------GKIFVGGLSSEISDDEIRNFFSEFG 508 +P A A+H KI+V +S++I ++ FFS FG Sbjct: 207 PVQGNPVVAPAQHFNPENVQRKIYVSNVSADIDPQKLLEFFSRFG 251 Score = 35.9 bits (79), Expect = 0.026 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 421 F +GEIE + D TGR +GFA V+++ ES K + T + KA Sbjct: 247 FSRFGEIEEGPLGLDKATGRPKGFALFVYRSLESAKKALEEPHKTFEGHVLHCHKA 302 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/52 (32%), Positives = 30/52 (57%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 409 F +GEI + TD NTG+S+G+ F+ F+ +S + +A I+ +K + Sbjct: 37 FEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKAN 88 Score = 33.9 bits (74), Expect = 0.10 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 K+FVGGL+ E DE+R +F +FG Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFG 41 Score = 32.7 bits (71), Expect = 0.24 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 3/62 (4%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKPDGP 681 ILE + DK + KG+ F+TF + P I G++ + A+ P+P P Sbjct: 43 ILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKANCNIASFGRPRPSPP 102 Query: 682 GG 687 G Sbjct: 103 RG 104 Score = 31.5 bits (68), Expect = 0.56 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDHLE 260 K+FVGGL+WET E+R + E Sbjct: 18 KVFVGGLAWETPTDEMRRYFE 38 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/52 (32%), Positives = 30/52 (57%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 409 F +GEI + TD NTG+S+G+ F+ F+ +S + +A I+ +K + Sbjct: 37 FEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKAN 88 Score = 33.9 bits (74), Expect = 0.10 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 K+FVGGL+ E DE+R +F +FG Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFG 41 Score = 32.7 bits (71), Expect = 0.24 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 3/62 (4%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKPDGP 681 ILE + DK + KG+ F+TF + P I G++ + A+ P+P P Sbjct: 43 ILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKANCNIASFGRPRPSPP 102 Query: 682 GG 687 G Sbjct: 103 RG 104 Score = 31.5 bits (68), Expect = 0.56 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDHLE 260 K+FVGGL+WET E+R + E Sbjct: 18 KVFVGGLAWETPTDEMRRYFE 38 >At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 100 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/56 (37%), Positives = 29/56 (51%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 421 F +GEI V D T RS+GF F+ F+ ES + HTI+ + V+ K A Sbjct: 29 FERFGEIVYAKVVCDGATQRSKGFGFVTFREVESATRACENPNHTIDGRTVNCKLA 84 Score = 30.7 bits (66), Expect = 0.97 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 660 I+ ++ D + KGF F+TF + + P TI G+ V+ K A Sbjct: 35 IVYAKVVCDGATQRSKGFGFVTFREVESATRACENPNHTIDGRTVNCKLA 84 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 406 +F YGEI +V D +TGR++GF F++FK + + E + N+ V Sbjct: 182 AFEVYGEITECSVVMDKDTGRAKGFGFVLFKTRKGARAALKNPEKRMYNRTV 233 Score = 31.1 bits (67), Expect = 0.73 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDG 678 I E + DK + KGF F+ F++ + LK P++ + + V A P G Sbjct: 189 ITECSVVMDKDTGRAKGFGFVLFKTRKGARAALKNPEKRMYNRTVSCLPARPFNSG 244 >At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/56 (37%), Positives = 30/56 (53%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 421 F AYG++E + D TG+SRGFA V+K E +A I+ K ++ K A Sbjct: 187 FMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 Score = 35.9 bits (79), Expect = 0.026 Identities = 22/81 (27%), Positives = 40/81 (49%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 433 F +YG++E V D TG+S+G+ F+ F +D + A + +KK+D + + Sbjct: 95 FSSYGDLEEAIVILDKVTGKSKGYGFVTFM---HVDGALLALKEP--SKKIDGRVTVTQL 149 Query: 434 GKIFVGGLSSEISDDEIRNFF 496 G S+I+D +R + Sbjct: 150 AASGNQGTGSQIADISMRKIY 170 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/54 (25%), Positives = 24/54 (44%) Frame = +1 Query: 517 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDG 678 E + FDK + +GF +++ + L P + I GK ++ K A G Sbjct: 195 EGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLAVDGKKG 248 >At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/56 (37%), Positives = 30/56 (53%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 421 F AYG++E + D TG+SRGFA V+K E +A I+ K ++ K A Sbjct: 187 FMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 Score = 35.9 bits (79), Expect = 0.026 Identities = 22/81 (27%), Positives = 40/81 (49%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 433 F +YG++E V D TG+S+G+ F+ F +D + A + +KK+D + + Sbjct: 95 FSSYGDLEEAIVILDKVTGKSKGYGFVTFM---HVDGALLALKEP--SKKIDGRVTVTQL 149 Query: 434 GKIFVGGLSSEISDDEIRNFF 496 G S+I+D +R + Sbjct: 150 AASGNQGTGSQIADISMRKIY 170 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/54 (25%), Positives = 24/54 (44%) Frame = +1 Query: 517 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDG 678 E + FDK + +GF +++ + L P + I GK ++ K A G Sbjct: 195 EGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLAVDGKKG 248 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 39.5 bits (88), Expect = 0.002 Identities = 26/95 (27%), Positives = 50/95 (52%), Gaps = 10/95 (10%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFK-------APESIDKVMAAGEHTINNK---K 403 F +G I S V T + G+SRG+ F+ F+ A ++++ + A + K K Sbjct: 132 FKKFGNIVSCKVATLED-GKSRGYGFVQFEQEDAAHAAIQTLNSTIVADKEIYVGKFMKK 190 Query: 404 VDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 508 D K + ++ +++ L +++S+D +R F+EFG Sbjct: 191 TDRVKPEEKYTNLYMKNLDADVSEDLLREKFAEFG 225 Score = 29.1 bits (62), Expect = 3.0 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKV 367 F G I S + D G+S+GF F+ F P E+ID V Sbjct: 324 FSQCGTITSTKLMCDEK-GKSKGFGFVCFSTPEEAIDAV 361 Score = 27.5 bits (58), Expect = 9.0 Identities = 17/94 (18%), Positives = 43/94 (45%), Gaps = 8/94 (8%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-------- 406 +F + + S+ + D ++GRS + + F + + + + +++ N K+ Sbjct: 43 AFAEFKSLTSVRLCKDASSGRSLCYGYANFLSRQDANLAIEKKNNSLLNGKMIRVMWSVR 102 Query: 407 DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 508 P + G +FV L +++ +++ F +FG Sbjct: 103 APDARRNGVGNVFVKNLPESVTNAVLQDMFKKFG 136 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKA 427 +F YG++ + D TGRSRGF F+ FK +++ D + ++ + + +A++ Sbjct: 27 AFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQS 86 Query: 428 R 430 R Sbjct: 87 R 87 Score = 33.1 bits (72), Expect = 0.18 Identities = 14/60 (23%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPGG 687 +++ ++ D+ + +GF F+TF+ E+ + D ++ + + G+ + V A + G GG Sbjct: 34 VIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQSRGSGGGG 93 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKA 427 +F YG++ + D TGRSRGF F+ FK +++ D + ++ + + +A++ Sbjct: 27 AFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQS 86 Query: 428 R 430 R Sbjct: 87 R 87 Score = 33.1 bits (72), Expect = 0.18 Identities = 14/60 (23%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPGG 687 +++ ++ D+ + +GF F+TF+ E+ + D ++ + + G+ + V A + G GG Sbjct: 34 VIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQSRGSGGGG 93 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/34 (50%), Positives = 22/34 (64%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 355 F +GEI V TD NTGRS+G+ F+ FK E+ Sbjct: 42 FEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEA 75 Score = 31.9 bits (69), Expect = 0.42 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 KIFVGGL+ E D +R +F +FG Sbjct: 23 KIFVGGLAWETQRDTMRRYFEQFG 46 Score = 29.1 bits (62), Expect = 3.0 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDHLE 260 K+FVGGL+WET +R + E Sbjct: 23 KIFVGGLAWETQRDTMRRYFE 43 Score = 27.5 bits (58), Expect = 9.0 Identities = 17/65 (26%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA---TPKPDGP 681 I+E + DK + KG+ F+TF+ + + I G+ + A KP P Sbjct: 48 IVEAVVITDKNTGRSKGYGFVTFKEAEAAMRACQNMNPVIDGRRANCNLACLGAQKPRPP 107 Query: 682 GGIRH 696 RH Sbjct: 108 TSPRH 112 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNK 400 F YGEIE V D TG+++GF F++FK + + + + I N+ Sbjct: 124 FEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNR 172 Score = 33.1 bits (72), Expect = 0.18 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 684 I E + DK + KGF F+ F++ + + LK PK+ I + + A+ P G Sbjct: 130 IEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNRTATCQLASMGPAASG 187 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNK 400 F YGEIE V D TG+++GF F++FK + + + + I N+ Sbjct: 124 FEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNR 172 Score = 33.1 bits (72), Expect = 0.18 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 684 I E + DK + KGF F+ F++ + + LK PK+ I + + A+ P G Sbjct: 130 IEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNRTATCQLASMGPAASG 187 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 376 +F YGE+ V D TGRSRGF F+ F + E+ + A Sbjct: 59 AFTKYGEVVDTRVILDRETGRSRGFGFVTFTSSEAASSAIQA 100 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/59 (23%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRATPKPDGPG 684 +++ + D+ + +GF F+TF S + + ++ R + G+ V V A + G G Sbjct: 66 VVDTRVILDRETGRSRGFGFVTFTSSEAASSAIQALDGRDLHGRVVKVNYANDRTSGGG 124 Score = 28.3 bits (60), Expect = 5.2 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 K+F+GG++ + +D +R F+++G Sbjct: 41 KLFIGGMAYSMDEDSLREAFTKYG 64 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/81 (23%), Positives = 35/81 (43%) Frame = +2 Query: 266 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIF 445 GEI + + D ++G S+G+AF+ FK + K + K ++F Sbjct: 140 GEIFEVRLMKDRDSGDSKGYAFVAFKTKDVAQKAIEELHSKEFKGKTIRCSLSETKNRLF 199 Query: 446 VGGLSSEISDDEIRNFFSEFG 508 +G + ++DE R + G Sbjct: 200 IGNIPKNWTEDEFRKVIEDVG 220 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/24 (50%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = +2 Query: 272 IESINVKTDP-NTGRSRGFAFIVF 340 +E+I + DP NT R+RGFAF+++ Sbjct: 223 VENIELIKDPTNTTRNRGFAFVLY 246 Score = 27.5 bits (58), Expect = 9.0 Identities = 9/27 (33%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +2 Query: 431 HG-KIFVGGLSSEISDDEIRNFFSEFG 508 HG ++F+GGL ++ ++++R+ E G Sbjct: 114 HGSEVFIGGLPRDVGEEDLRDLCEEIG 140 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA-GEHTINNKKVDPKKAKA 427 +F YG + V D +GRSRGF FI F +++D+ +AA ++ + + KA+ Sbjct: 26 AFEKYGHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDKAQP 85 Query: 428 RHG 436 G Sbjct: 86 HQG 88 Score = 34.3 bits (75), Expect = 0.079 Identities = 15/59 (25%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPG 684 ++E ++ DK + +GF FITF+ ++ +++ + + G+ + V +A P G G Sbjct: 33 LVEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDKAQPHQGGAG 91 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/37 (40%), Positives = 25/37 (67%), Gaps = 3/37 (8%) Frame = +3 Query: 186 DDDRKLFVGGLSWETTDKELRDHLE---HTVK*RVLM 287 D + + F+GGL+W T+D+ LRD E H V+ +V++ Sbjct: 4 DPEYRCFIGGLAWTTSDRGLRDAFEKYGHLVEAKVVL 40 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 38.7 bits (86), Expect = 0.004 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 12/97 (12%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-----DPKK 418 F + + +N+ + T RG F+ E DKV+ ++ +NKK P + Sbjct: 32 FREFSIVNEVNIIKEKTTRAPRGCCFLTCPTREDADKVI----NSFHNKKTLPGASSPLQ 87 Query: 419 AKARHG-------KIFVGGLSSEISDDEIRNFFSEFG 508 K G K+FVG L +S+ E+++ FSE+G Sbjct: 88 VKYADGELERLEHKLFVGMLPKNVSETEVQSLFSEYG 124 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 36.3 bits (80), Expect = 0.020 Identities = 15/55 (27%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRATPKP 672 ++E + +D+ + KGF F+T++S Q V + +K+ + G+++ V A +P Sbjct: 230 VVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEAEARP 284 Score = 34.7 bits (76), Expect(2) = 0.004 Identities = 20/61 (32%), Positives = 31/61 (50%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 433 F + G +E + V D TGRSRGF F+ S+ +V AA + N ++D + + Sbjct: 111 FESAGNVEMVEVIYDKITGRSRGFGFVTM---SSVSEVEAAAQQ-FNGYELDGRPLRVNA 166 Query: 434 G 436 G Sbjct: 167 G 167 Score = 31.1 bits (67), Expect = 0.73 Identities = 13/60 (21%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT-INNKKVDPKKAKAR 430 F G++ V D ++GRS+GF F+ + + + + + + + ++ +++ +A+AR Sbjct: 224 FSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEAEAR 283 Score = 23.0 bits (47), Expect(2) = 0.004 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 +++VG LS + D + + FSE G Sbjct: 205 RVYVGNLSWGVDDMALESLFSEQG 228 >At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 169 Score = 38.3 bits (85), Expect = 0.005 Identities = 20/56 (35%), Positives = 28/56 (50%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 421 F +GEI +NV D T RS+G+ F+ FK ES + TI + + K A Sbjct: 33 FKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACKDPNPTIEGRITNCKLA 88 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 37.9 bits (84), Expect = 0.006 Identities = 15/85 (17%), Positives = 43/85 (50%), Gaps = 1/85 (1%) Frame = +2 Query: 257 GAYGEIESINVKTDPNTGRSRGFAFIVFKAPE-SIDKVMAAGEHTINNKKVDPKKAKARH 433 G+ GE+ + + + ++G +G+AF+ F++ + + + + K++ +A+H Sbjct: 113 GSIGEVTEVRIMREKDSGDGKGYAFVTFRSKDLAAEAIDTLNNTDFRGKRIKCSTTQAKH 172 Query: 434 GKIFVGGLSSEISDDEIRNFFSEFG 508 ++F+G + + +I+ + G Sbjct: 173 -RLFLGNVPRNWMESDIKKAANRIG 196 Score = 28.3 bits (60), Expect = 5.2 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +1 Query: 502 IWTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRT-IGGKEV 645 I + EV + +K KG+ F+TF S+ + + + T T GK + Sbjct: 115 IGEVTEVRIMREKDSGDGKGYAFVTFRSKDLAAEAIDTLNNTDFRGKRI 163 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 37.9 bits (84), Expect = 0.006 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 355 F YGEI +N+ D TG+S+GFAF+ ++ S Sbjct: 56 FSQYGEIVDVNLIRDKGTGKSKGFAFLAYEDQRS 89 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 37.9 bits (84), Expect = 0.006 Identities = 20/86 (23%), Positives = 39/86 (45%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 433 FG GE+ + + +P T +S+G AF+ F E + + + + N K A + Sbjct: 234 FGHVGEVTEVRILKNPQTKKSKGSAFLRFATVEQAKRAVKELKSPMINGKKCGVTASQDN 293 Query: 434 GKIFVGGLSSEISDDEIRNFFSEFGL 511 +FVG + + + +R +G+ Sbjct: 294 DTLFVGNICKIWTPEALREKLKHYGV 319 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 37.5 bits (83), Expect = 0.008 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 8/71 (11%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVF-------KAPESID-KVMAAGEHTINNKKVD 409 F YG++ + + D TG SRGFAF+ + KA E +D +V+ E T+ K Sbjct: 36 FAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYG 95 Query: 410 PKKAKARHGKI 442 P K G++ Sbjct: 96 PNAEKISKGRV 106 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 37.5 bits (83), Expect = 0.008 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 8/71 (11%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVF-------KAPESID-KVMAAGEHTINNKKVD 409 F YG++ + + D TG SRGFAF+ + KA E +D +V+ E T+ K Sbjct: 36 FAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYG 95 Query: 410 PKKAKARHGKI 442 P K G++ Sbjct: 96 PNAEKISKGRV 106 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 37.5 bits (83), Expect = 0.008 Identities = 16/52 (30%), Positives = 29/52 (55%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 409 F +GEI + TD TG+S+G+ F+ F+ +S + +A I+ +K + Sbjct: 37 FDQFGEILEAVIITDKATGKSKGYGFVTFRDSDSATRAVADPNPVIDGRKAN 88 Score = 36.3 bits (80), Expect = 0.020 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +2 Query: 431 HGKIFVGGLSSEISDDEIRNFFSEFG 508 H K+FVGGL+ E DE+R +F +FG Sbjct: 16 HTKVFVGGLAWETPTDEMRRYFDQFG 41 Score = 32.7 bits (71), Expect = 0.24 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 3/62 (4%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKPDGP 681 ILE + DK + KG+ F+TF + P I G++ + A+ P+P P Sbjct: 43 ILEAVIITDKATGKSKGYGFVTFRDSDSATRAVADPNPVIDGRKANCNIASFGRPRPSTP 102 Query: 682 GG 687 G Sbjct: 103 RG 104 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDHLE 260 K+FVGGL+WET E+R + + Sbjct: 18 KVFVGGLAWETPTDEMRRYFD 38 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 370 +F ++GE+ V D TGRSRGF F+ F +S + + Sbjct: 54 AFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAI 93 Score = 30.7 bits (66), Expect = 0.97 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = +3 Query: 111 NQLNGNAENGGGDSQDHNSAXAPG--RDDDRKLFVGGLSWETTDKELR 248 N+L+G G S + G R KLFVGGLSW T D L+ Sbjct: 5 NKLSGILRQGVSQSSNGPVTSMLGSLRYMSSKLFVGGLSWGTDDSSLK 52 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 K+FVGGLS D ++ F+ FG Sbjct: 36 KLFVGGLSWGTDDSSLKQAFTSFG 59 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 370 +F ++GE+ V D TGRSRGF F+ F +S + + Sbjct: 54 AFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAI 93 Score = 30.7 bits (66), Expect = 0.97 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = +3 Query: 111 NQLNGNAENGGGDSQDHNSAXAPG--RDDDRKLFVGGLSWETTDKELR 248 N+L+G G S + G R KLFVGGLSW T D L+ Sbjct: 5 NKLSGILRQGVSQSSNGPVTSMLGSLRYMSSKLFVGGLSWGTDDSSLK 52 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 K+FVGGLS D ++ F+ FG Sbjct: 36 KLFVGGLSWGTDDSSLKQAFTSFG 59 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 37.1 bits (82), Expect = 0.011 Identities = 22/56 (39%), Positives = 31/56 (55%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK 418 +FG YG I S V D + G+SR F F+ F+ PE + + A +N KK D K+ Sbjct: 244 TFGQYGSISSAVVMRDGD-GKSRCFGFVNFENPEDAARAVEA----LNGKKFDDKE 294 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 37.1 bits (82), Expect = 0.011 Identities = 17/63 (26%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI-NNKKVDPKKAKAR 430 F G++ +++ DP T SRGF FI K+ ++ + + +H++ + + +KA+ R Sbjct: 95 FAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVEKARRR 154 Query: 431 HGK 439 G+ Sbjct: 155 RGR 157 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 36.7 bits (81), Expect = 0.015 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 373 +F ++G++ V TD ++GRS+GF F+ + E +K A Sbjct: 53 AFASFGQLVDARVITDRDSGRSKGFGFVTYATIEDAEKAKA 93 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 36.3 bits (80), Expect = 0.020 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +2 Query: 263 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 373 Y + V TDP+TGRS+G+ F+ F ++ MA Sbjct: 140 YSSVRGAKVVTDPSTGRSKGYGFVKFAEESERNRAMA 176 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 36.3 bits (80), Expect = 0.020 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 370 F YG + S+ V D GRSRGF F+ F PE+ K M Sbjct: 222 FSQYGTVSSVVVMRD-GMGRSRGFGFVNFCNPENAKKAM 259 Score = 32.3 bits (70), Expect = 0.32 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVF 340 FG YG+I S V N GRS+GF F+ F Sbjct: 324 FGCYGQIVSAKVMCHEN-GRSKGFGFVCF 351 Score = 27.9 bits (59), Expect = 6.8 Identities = 24/97 (24%), Positives = 42/97 (43%), Gaps = 12/97 (12%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES-------IDKVMAAGEHTINNKKVDP 412 F +G I S V + G+S+GF F+ F +S + M G+ K ++ Sbjct: 132 FCPFGSILSCKVVEE--NGQSKGFGFVQFDTEQSAVSARSALHGSMVYGKKLFVAKFINK 189 Query: 413 KKAKARHG-----KIFVGGLSSEISDDEIRNFFSEFG 508 + A G ++V L ++DD + FS++G Sbjct: 190 DERAAMAGNQDSTNVYVKNLIETVTDDCLHTLFSQYG 226 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 36.3 bits (80), Expect = 0.020 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 409 F +G+I V TD ++GRS+G+ F+ F PE+ K I+ ++ + Sbjct: 27 FEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGRRAN 78 Score = 31.1 bits (67), Expect = 0.73 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 K+FVGGL+ E +RN+F +FG Sbjct: 8 KVFVGGLAWETHKVSLRNYFEQFG 31 Score = 30.7 bits (66), Expect = 0.97 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDHLE 260 K+FVGGL+WET LR++ E Sbjct: 8 KVFVGGLAWETHKVSLRNYFE 28 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 36.3 bits (80), Expect = 0.020 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 409 F +G+I V TD ++GRS+G+ F+ F PE+ K I+ ++ + Sbjct: 27 FEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGRRAN 78 Score = 31.1 bits (67), Expect = 0.73 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 K+FVGGL+ E +RN+F +FG Sbjct: 8 KVFVGGLAWETHKVSLRNYFEQFG 31 Score = 30.7 bits (66), Expect = 0.97 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDHLE 260 K+FVGGL+WET LR++ E Sbjct: 8 KVFVGGLAWETHKVSLRNYFE 28 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 35.9 bits (79), Expect = 0.026 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 14/92 (15%) Frame = +2 Query: 269 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP-----------K 415 EI S+ V + N G S G+ F+ F++ + DKV+ T P + Sbjct: 128 EIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFNGTTMPNTDQPFRLNWASFSTGE 187 Query: 416 KAKARHG---KIFVGGLSSEISDDEIRNFFSE 502 K +G IFVG LS ++SD+ + FSE Sbjct: 188 KRLENNGPDLSIFVGDLSPDVSDNLLHETFSE 219 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 263 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 370 Y +++ V D NTGRS+G+ F+ F K M Sbjct: 221 YPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 256 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 35.9 bits (79), Expect = 0.026 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 14/92 (15%) Frame = +2 Query: 269 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP-----------K 415 EI S+ V + N G S G+ F+ F++ + DKV+ T P + Sbjct: 128 EIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFNGTTMPNTDQPFRLNWASFSTGE 187 Query: 416 KAKARHG---KIFVGGLSSEISDDEIRNFFSE 502 K +G IFVG LS ++SD+ + FSE Sbjct: 188 KRLENNGPDLSIFVGDLSPDVSDNLLHETFSE 219 Score = 33.1 bits (72), Expect = 0.18 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = +2 Query: 440 IFVGGLSSEISDDEIRNFFSEFG 508 IFVGGL S ++D++++ F+EFG Sbjct: 306 IFVGGLDSSVTDEDLKQPFNEFG 328 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 263 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 370 Y +++ V D NTGRS+G+ F+ F K M Sbjct: 221 YPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 256 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 35.5 bits (78), Expect = 0.034 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 6/61 (9%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA------GEHTINNKKVDP 412 +F +G+I + + +TGRSRGF FI F ++D+ + G+ I+ + +P Sbjct: 26 AFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVNRAEP 85 Query: 413 K 415 K Sbjct: 86 K 86 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/29 (51%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = +2 Query: 425 ARHG-KIFVGGLSSEISDDEIRNFFSEFG 508 A+ G +IFVGGLS E++D ++ FS FG Sbjct: 3 AKEGSRIFVGGLSPEVTDRDLERAFSRFG 31 Score = 33.5 bits (73), Expect = 0.14 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPGG 687 IL+ ++ ++ + +GF FITF + +++ ++ R G + + V RA PK G Sbjct: 33 ILDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVNRAEPKLGRDDG 92 Query: 688 IRH 696 H Sbjct: 93 ESH 95 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 35.5 bits (78), Expect = 0.034 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 409 +F +G++ + D +GRSRGF F+ FK +K M +N K++D Sbjct: 25 TFSQFGDVIDSKIINDRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKELD 73 Score = 33.5 bits (73), Expect = 0.14 Identities = 14/60 (23%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPGG 687 +++ ++ D+ + +GF F+TF+ E+ + D ++ + + G+ + V A + G GG Sbjct: 32 VIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQSRGSGGGG 91 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 + FVGGL+ +D++++ FS+FG Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFG 30 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 35.5 bits (78), Expect = 0.034 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 409 +F +G++ + D +GRSRGF F+ FK +K M +N K++D Sbjct: 25 TFSQFGDVIDSKIINDRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKELD 73 Score = 33.5 bits (73), Expect = 0.14 Identities = 14/60 (23%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPGG 687 +++ ++ D+ + +GF F+TF+ E+ + D ++ + + G+ + V A + G GG Sbjct: 32 VIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQSRGSGGGG 91 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 + FVGGL+ +D++++ FS+FG Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFG 30 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 35.5 bits (78), Expect = 0.034 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 409 +F +G++ + D +GRSRGF F+ FK +K M +N K++D Sbjct: 25 TFSQFGDVIDSKIINDRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKELD 73 Score = 33.5 bits (73), Expect = 0.14 Identities = 14/60 (23%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPGG 687 +++ ++ D+ + +GF F+TF+ E+ + D ++ + + G+ + V A + G GG Sbjct: 32 VIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQSRGSGGGG 91 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 + FVGGL+ +D++++ FS+FG Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFG 30 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 35.5 bits (78), Expect = 0.034 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 421 F +GEIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 532 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 672 FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 173 FDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 33.1 bits (72), Expect = 0.18 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKA 346 +F YGEIE D +G+S+G+ FI++K+ Sbjct: 159 AFKQYGEIEDCKAVFDKISGKSKGYGFILYKS 190 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 35.5 bits (78), Expect = 0.034 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 421 F +GEIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 532 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 672 FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 173 FDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 33.1 bits (72), Expect = 0.18 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKA 346 +F YGEIE D +G+S+G+ FI++K+ Sbjct: 159 AFKQYGEIEDCKAVFDKISGKSKGYGFILYKS 190 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 35.5 bits (78), Expect = 0.034 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 421 F +GEIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 532 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 672 FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 173 FDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 33.1 bits (72), Expect = 0.18 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKA 346 +F YGEIE D +G+S+G+ FI++K+ Sbjct: 159 AFKQYGEIEDCKAVFDKISGKSKGYGFILYKS 190 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 35.1 bits (77), Expect = 0.045 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = +2 Query: 440 IFVGGLSSEISDDEIRNFFSEFG 508 IFVGGL + ++DDE+++ F +FG Sbjct: 262 IFVGGLDANVTDDELKSIFGQFG 284 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 263 YGEIESINVKTDPNTGRSRGFAFIVF 340 YG ++ V D TGRS+G+ F+ F Sbjct: 178 YGSVKGAKVVLDRTTGRSKGYGFVRF 203 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 35.1 bits (77), Expect = 0.045 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 373 +FG + V + NTGRSRGF FI F++ E++ +A Sbjct: 238 AFGDQPGVLGAKVIYERNTGRSRGFGFISFESAENVQSALA 278 Score = 32.3 bits (70), Expect = 0.32 Identities = 20/79 (25%), Positives = 36/79 (45%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 433 FG G + + + D T RSRGF F+ + E + M N+ ++ + K Sbjct: 136 FGEAGTVVDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAM----QMFNSSQIGGRTVKVNF 191 Query: 434 GKIFVGGLSSEISDDEIRN 490 ++ GG +E+ +IR+ Sbjct: 192 PEVPRGG-ENEVMRTKIRD 209 Score = 30.7 bits (66), Expect = 0.97 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +1 Query: 508 TILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEVDV 651 T+++V++ +DK ++ +GF F+T S E+ + IGG+ V V Sbjct: 141 TVVDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAMQMFNSSQIGGRTVKV 189 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 35.1 bits (77), Expect = 0.045 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAAGEHTINNKKVDPKKA 421 F G++ S V P T +S GF F+ F + E ++ ++A + +K+ KA Sbjct: 197 FSEKGKVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAAIVALNNSLLEGQKIRVNKA 253 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 Query: 263 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 370 +G +E + V D +GRSR F F K+ E + V+ Sbjct: 99 HGAVEKVQVMYDKYSGRSRRFGFATMKSVEDANAVV 134 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 35.1 bits (77), Expect = 0.045 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVF 340 +F ++GE+ + + D +GRSRGF F+ F Sbjct: 60 AFSSFGEVAEVRIAYDKGSGRSRGFGFVDF 89 Score = 29.5 bits (63), Expect = 2.2 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 K+F+GGLS + + +++ FS FG Sbjct: 42 KLFIGGLSWSVDEQSLKDAFSSFG 65 Score = 29.5 bits (63), Expect = 2.2 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRD 251 KLF+GGLSW ++ L+D Sbjct: 42 KLFIGGLSWSVDEQSLKD 59 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 35.1 bits (77), Expect = 0.045 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI 358 F +GE+ + D TGRS+GF F+ FK +S+ Sbjct: 64 FNEFGEVFDSKIIIDRETGRSKGFRFVTFKDEDSM 98 Score = 31.5 bits (68), Expect = 0.56 Identities = 16/58 (27%), Positives = 31/58 (53%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 684 + + ++ D+ + KGF F+TF+ E D ++T + G+E+D + T + G G Sbjct: 70 VFDSKIIIDRETGRSKGFRFVTFKDE----DSMRTAIDRMNGQELDGRNITAQARGSG 123 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 35.1 bits (77), Expect = 0.045 Identities = 29/110 (26%), Positives = 54/110 (49%), Gaps = 24/110 (21%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE----SIDKV--MAAGEHTI----NNK 400 +FG YG+I S V D +G SR F F+ F +PE +++K+ ++ GE + K Sbjct: 244 TFGKYGDISSAVVMKD-QSGNSRSFGFVNFVSPEAAAVAVEKMNGISLGEDVLYVGRAQK 302 Query: 401 KVDPKK--------------AKARHGKIFVGGLSSEISDDEIRNFFSEFG 508 K D ++ K + +++ L ++D++++ FSE+G Sbjct: 303 KSDREEELRRKFEQERISRFEKLQGSNLYLKNLDDSVNDEKLKEMFSEYG 352 Score = 33.1 bits (72), Expect = 0.18 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 8/93 (8%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT-INNKKV-------D 409 F + ++ V D T RS G+A++ F PE + M + + I ++ + D Sbjct: 65 FNQVAPVHNLRVCRDL-THRSLGYAYVNFANPEDASRAMESLNYAPIRDRPIRIMLSNRD 123 Query: 410 PKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 508 P + G +F+ L + I + + FS FG Sbjct: 124 PSTRLSGKGNVFIKNLDASIDNKALYETFSSFG 156 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 352 F YG + S V + + G SRGF F+ + PE Sbjct: 348 FSEYGNVTSCKVMMN-SQGLSRGFGFVAYSNPE 379 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 35.1 bits (77), Expect = 0.045 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKA 427 +F YG+I + +TGR RGF FI F D + + NK + KA+ Sbjct: 31 TFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEP 90 Query: 428 RHG 436 + G Sbjct: 91 KVG 93 Score = 33.5 bits (73), Expect = 0.14 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TPKRTIGGKEVDVKRATPKPDG 678 I E ++ + + +GF FITF + +D +K R +G K + V +A PK G Sbjct: 38 ITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPKVGG 94 Score = 29.5 bits (63), Expect = 2.2 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = +3 Query: 192 DRKLFVGGLSWETTDKEL 245 + ++FVGGLSW+ T+++L Sbjct: 11 ESRIFVGGLSWDVTERQL 28 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 35.1 bits (77), Expect = 0.045 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKA 427 +F YG+I + +TGR RGF FI F D + + NK + KA+ Sbjct: 31 TFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEP 90 Query: 428 RHG 436 + G Sbjct: 91 KVG 93 Score = 33.5 bits (73), Expect = 0.14 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TPKRTIGGKEVDVKRATPKPDG 678 I E ++ + + +GF FITF + +D +K R +G K + V +A PK G Sbjct: 38 ITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPKVGG 94 Score = 29.5 bits (63), Expect = 2.2 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = +3 Query: 192 DRKLFVGGLSWETTDKEL 245 + ++FVGGLSW+ T+++L Sbjct: 11 ESRIFVGGLSWDVTERQL 28 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 34.7 bits (76), Expect = 0.060 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVF 340 F A+G +E + + DP TG+ +GF FI F Sbjct: 285 FEAFGPVELVQLPLDPETGQCKGFGFIQF 313 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 34.7 bits (76), Expect = 0.060 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDHLEH 263 KLF+GGLSW T D LRD H Sbjct: 36 KLFIGGLSWGTDDASLRDAFAH 57 Score = 32.3 bits (70), Expect = 0.32 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVF 340 +F +G++ V D TGRSRGF F+ F Sbjct: 54 AFAHFGDVVDAKVIVDRETGRSRGFGFVNF 83 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 K+F+GGLS D +R+ F+ FG Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFG 59 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 34.7 bits (76), Expect = 0.060 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDHLEH 263 KLF+GGLSW T D LRD H Sbjct: 36 KLFIGGLSWGTDDASLRDAFAH 57 Score = 32.3 bits (70), Expect = 0.32 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVF 340 +F +G++ V D TGRSRGF F+ F Sbjct: 54 AFAHFGDVVDAKVIVDRETGRSRGFGFVNF 83 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 K+F+GGLS D +R+ F+ FG Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFG 59 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 34.7 bits (76), Expect = 0.060 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 3/53 (5%) Frame = +2 Query: 251 SFGAYGEIESI-NVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTINNK 400 +F A+G I S + DP+TG SRGF FI + + E+ D + + G++ N + Sbjct: 131 TFSAFGVIASNPKIMRDPDTGNSRGFGFISYDSFEASDAAIESMTGQYLSNRQ 183 Score = 31.1 bits (67), Expect = 0.73 Identities = 22/89 (24%), Positives = 41/89 (46%), Gaps = 7/89 (7%) Frame = +2 Query: 266 GEIESINVKTDPNTGRSRGFAFIVFKAPESID---KVMAA----GEHTINNKKVDPKKAK 424 G + ++ V D T + + FI +++ E D KV+ G+ NK KK+ Sbjct: 49 GPVVNVYVPKDRVTNLHQNYGFIEYRSEEDADYAIKVLNMIKLHGKPIRVNKASQDKKSL 108 Query: 425 ARHGKIFVGGLSSEISDDEIRNFFSEFGL 511 +F+G L ++ + + + FS FG+ Sbjct: 109 DVGANLFIGNLDPDVDEKLLYDTFSAFGV 137 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 34.7 bits (76), Expect = 0.060 Identities = 18/53 (33%), Positives = 30/53 (56%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 409 +FG++G+I V D +G SRGF F+ + + E + M A + NK++D Sbjct: 55 AFGSFGKIVDAVVVLDRESGLSRGFGFVTYDSIEVANNAMQA----MQNKELD 103 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRATPKPDGPGG 687 I++ + D+ +GF F+T++S +V N+ ++ + + G+ + V A G GG Sbjct: 62 IVDAVVVLDRESGLSRGFGFVTYDSIEVANNAMQAMQNKELDGRIIGVHPADSGGGGGGG 121 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 34.7 bits (76), Expect = 0.060 Identities = 11/23 (47%), Positives = 19/23 (82%) Frame = +2 Query: 440 IFVGGLSSEISDDEIRNFFSEFG 508 +FVGGL + ++DD ++N FS++G Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYG 285 >At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 306 Score = 34.7 bits (76), Expect = 0.060 Identities = 11/23 (47%), Positives = 19/23 (82%) Frame = +2 Query: 440 IFVGGLSSEISDDEIRNFFSEFG 508 +FVGGL + ++DD ++N FS++G Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYG 285 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 34.3 bits (75), Expect = 0.079 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 376 +FG +GEI+++N+ D +G +G+A I ++ E ++A Sbjct: 114 AFGDFGEIKNLNLNLDRRSGYVKGYALIEYEKKEEAQSAISA 155 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 34.3 bits (75), Expect = 0.079 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = +2 Query: 440 IFVGGLSSEISDDEIRNFFSEFG 508 IFVGGL S ++D++++ FSEFG Sbjct: 308 IFVGGLDSSVTDEDLKQPFSEFG 330 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 263 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 370 Y +++ V D NTGRS+G+ F+ F K M Sbjct: 223 YPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 258 >At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing protein low similarity to tumor-rejection antigen SART3 [Mus musculus] GI:7637845; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 817 Score = 33.9 bits (74), Expect = 0.10 Identities = 17/62 (27%), Positives = 29/62 (46%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 433 FG G ++SI + +TG+ RG A+ F E + +A KK+ ++ + Sbjct: 671 FGDDGGVDSIRILHHKDTGKPRGLAYADFVDDEHLAAAIAKNRKMFFGKKISIARSNPKK 730 Query: 434 GK 439 GK Sbjct: 731 GK 732 >At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing protein low similarity to tumor-rejection antigen SART3 [Mus musculus] GI:7637845; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 816 Score = 33.9 bits (74), Expect = 0.10 Identities = 17/62 (27%), Positives = 29/62 (46%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 433 FG G ++SI + +TG+ RG A+ F E + +A KK+ ++ + Sbjct: 671 FGDDGGVDSIRILHHKDTGKPRGLAYADFVDDEHLAAAIAKNRKMFFGKKISIARSNPKK 730 Query: 434 GK 439 GK Sbjct: 731 GK 732 >At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing protein low similarity to poly(A) binding protein II from [Xenopus laevis] GI:11527140, [Mus musculus] GI:2351846, [Bos taurus] GI:1051125; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 537 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +2 Query: 266 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 373 G ++++ V TDP T +G AF+ F ES+ K +A Sbjct: 469 GAVQNVIVVTDPVTRHPKGTAFVTFATKESVGKAVA 504 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 260 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 376 ++G + N+ D TG S+G+AF V++ P D AA Sbjct: 397 SFGPLRGFNLVKDRETGNSKGYAFCVYQDPSVTDIACAA 435 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 33.5 bits (73), Expect = 0.14 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 376 F +G++ V +D TGRSRGF F+ ++ +AA Sbjct: 227 FSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVNVAIAA 267 Score = 31.1 bits (67), Expect = 0.73 Identities = 24/99 (24%), Positives = 40/99 (40%), Gaps = 14/99 (14%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKAR 430 F G +E V + +T +SRGF F+ E +K V +N +++ +A R Sbjct: 133 FEQAGTVEISEVIYNRDTDQSRGFGFVTMSTVEEAEKAVEKFNSFEVNGRRLTVNRAAPR 192 Query: 431 HG-------------KIFVGGLSSEISDDEIRNFFSEFG 508 +I+VG L ++ + FSE G Sbjct: 193 GSRPERQPRVYDAAFRIYVGNLPWDVDSGRLERLFSEHG 231 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 373 F +G + S V DPN G S+G F+ F PE + M+ Sbjct: 152 FSPFGTVTSSKVMRDPN-GTSKGSGFVAFATPEEATEAMS 190 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/50 (26%), Positives = 26/50 (52%) Frame = +2 Query: 359 DKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 508 DK + G + ++ D K + ++V L+ +DD+++N F E+G Sbjct: 5 DKQVYVGPF-LRRQERDSTANKTKFTNVYVKNLAESTTDDDLKNAFGEYG 53 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 33.5 bits (73), Expect = 0.14 Identities = 20/96 (20%), Positives = 43/96 (44%), Gaps = 11/96 (11%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA---------GEHTINNKKV 406 F +G + + + D TG+ +G F+ + + D+ + A G + + Sbjct: 140 FEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRALHNQITLPGGTGPVQVRYA 199 Query: 407 DPKKAK--ARHGKIFVGGLSSEISDDEIRNFFSEFG 508 D ++ + K+FVG L+ + ++ E+ F +FG Sbjct: 200 DGERERIGTLEFKLFVGSLNKQATEKEVEEIFLQFG 235 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 33.5 bits (73), Expect = 0.14 Identities = 20/96 (20%), Positives = 43/96 (44%), Gaps = 11/96 (11%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA---------GEHTINNKKV 406 F +G + + + D TG+ +G F+ + + D+ + A G + + Sbjct: 140 FEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRALHNQITLPGGTGPVQVRYA 199 Query: 407 DPKKAK--ARHGKIFVGGLSSEISDDEIRNFFSEFG 508 D ++ + K+FVG L+ + ++ E+ F +FG Sbjct: 200 DGERERIGTLEFKLFVGSLNKQATEKEVEEIFLQFG 235 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 33.5 bits (73), Expect = 0.14 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFI 334 F GE+ ++V TD TG SRGFA+I Sbjct: 503 FSKCGEVTRVHVPTDRETGASRGFAYI 529 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/56 (26%), Positives = 24/56 (42%) Frame = +2 Query: 341 KAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 508 K ++ V A + K + + +F G LS +I+ +I NFF E G Sbjct: 353 KKDSDVEMVDAEQKSNAKQPKTPTNQTQGGSKTLFAGNLSYQIARSDIENFFKEAG 408 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 33.5 bits (73), Expect = 0.14 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFK 343 SF A+ V D TGRSRGF F+ F+ Sbjct: 167 SFSAFNSCSDARVMWDQKTGRSRGFGFVSFR 197 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 33.1 bits (72), Expect = 0.18 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFK 343 +F +G++ + D +GRSRGF F+ FK Sbjct: 25 TFSQFGDVIDSKIINDRESGRSRGFGFVTFK 55 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 + FVGGL+ +D++++ FS+FG Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFG 30 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/42 (23%), Positives = 25/42 (59%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGG 636 +++ ++ D+ + +GF F+TF+ E+ + D ++ + GG Sbjct: 32 VIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGSGGG 73 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 33.1 bits (72), Expect = 0.18 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 376 F +G++ V D TGRSRGF F+ + +++ ++A Sbjct: 264 FSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISA 304 Score = 28.3 bits (60), Expect = 5.2 Identities = 23/99 (23%), Positives = 40/99 (40%), Gaps = 14/99 (14%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKA-PESIDKVMAAGEHTINNKKVDPKKAKAR 430 F G +E V + T +SRGF F+ + E+ V + +N + + KA R Sbjct: 170 FEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEAETAVEKFNRYDLNGRLLTVNKAAPR 229 Query: 431 HG-------------KIFVGGLSSEISDDEIRNFFSEFG 508 +++VG L ++ + + FSE G Sbjct: 230 GSRPERAPRVYEPAFRVYVGNLPWDVDNGRLEQLFSEHG 268 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/59 (23%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = +1 Query: 508 TILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 681 T+ E+ +++ +Q +GF F+T S ++ + K + + G+ + V +A P+ P Sbjct: 175 TVEIAEVIYNRETDQSRGFGFVTMSSVDEAETAVEKFNRYDLNGRLLTVNKAAPRGSRP 233 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 409 F +GEI V TD +GRS+G+ F+ F+ E+ I+ ++ + Sbjct: 33 FEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRAN 84 Score = 31.1 bits (67), Expect = 0.73 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDHLE 260 K+FVGGL+WET + ++ H E Sbjct: 14 KVFVGGLAWETHKETMKKHFE 34 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 409 F +GEI V TD +GRS+G+ F+ F+ E+ I+ ++ + Sbjct: 33 FEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRAN 84 Score = 31.1 bits (67), Expect = 0.73 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDHLE 260 K+FVGGL+WET + ++ H E Sbjct: 14 KVFVGGLAWETHKETMKKHFE 34 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 409 F +GEI V TD +GRS+G+ F+ F+ E+ I+ ++ + Sbjct: 33 FEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRAN 84 Score = 31.1 bits (67), Expect = 0.73 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDHLE 260 K+FVGGL+WET + ++ H E Sbjct: 14 KVFVGGLAWETHKETMKKHFE 34 >At5g43960.2 68418.m05378 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 391 Score = 32.7 bits (71), Expect = 0.24 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +1 Query: 532 FDKTKNQRKGFC--FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGGIR 693 F +T+ G C F+ FE V + +K +GG++V ++ P P G G R Sbjct: 289 FLRTRKDVMGVCYAFVEFEDMTSVENAIKASPIYLGGRQVYIEERRPNPAGVRGAR 344 >At5g43960.1 68418.m05379 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 450 Score = 32.7 bits (71), Expect = 0.24 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +1 Query: 532 FDKTKNQRKGFC--FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGGIR 693 F +T+ G C F+ FE V + +K +GG++V ++ P P G G R Sbjct: 348 FLRTRKDVMGVCYAFVEFEDMTSVENAIKASPIYLGGRQVYIEERRPNPAGVRGAR 403 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 32.7 bits (71), Expect = 0.24 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 8/65 (12%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG--------EHTINNKKVD 409 F +G ++ + V + TG+S+ F FI F+ PE + +AAG EH + ++ Sbjct: 80 FSQFGTVKRVRVARNKKTGKSKHFGFIQFEDPEVAE--IAAGAMNDYLLMEHMLKVHVIE 137 Query: 410 PKKAK 424 P+ K Sbjct: 138 PENVK 142 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 32.7 bits (71), Expect = 0.24 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 373 F +G I S V D TGR+R FAF+ F + E D ++ Sbjct: 232 FSKFGTIVSTRVLHDRKTGRNRVFAFLSFTSGEERDAALS 271 Score = 31.1 bits (67), Expect = 0.73 Identities = 32/110 (29%), Positives = 47/110 (42%), Gaps = 25/110 (22%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFK-------APESIDKVMAAGEH--------- 385 F +G + S+ V +P TG SRG ++ A S+D G Sbjct: 128 FQPFGTVISVEVSRNPQTGESRGSGYVTMGSINSAKIAIASLDGTEVGGREMRVRYSVDM 187 Query: 386 ---TINNKKV---DPKKA---KARHGKIFVGGLSSEISDDEIRNFFSEFG 508 T N +V PKK +++H K++VG L D +RN FS+FG Sbjct: 188 NPGTRRNPEVLNSTPKKILMYESQH-KVYVGNLPWFTQPDGLRNHFSKFG 236 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 32.3 bits (70), Expect = 0.32 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 376 +F ++ + V T+ TGRSRG+ F+ F + +S + ++A Sbjct: 50 AFSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAISA 91 >At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 952 Score = 32.3 bits (70), Expect = 0.32 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +2 Query: 407 DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 508 +P++ + GKIFVG L + I E FF +FG Sbjct: 156 NPQQEFRQEGKIFVGNLPTWIKKPEFEEFFRQFG 189 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 32.3 bits (70), Expect = 0.32 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI---NNKKVDPKKAK 424 F + I+ + + D T SRGFAF+ F + E K + A T N K + AK Sbjct: 478 FSKHAPIKDLRLVRDKFTHVSRGFAFVHFYSVEDATKALEATNRTALERNGKILRVAYAK 537 Query: 425 ARHG 436 + HG Sbjct: 538 SVHG 541 Score = 31.5 bits (68), Expect = 0.56 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 263 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH 385 +G + + V + N+G SRGFAFI F ++ +M EH Sbjct: 321 WGPLHHVRVIREQNSGISRGFAFIDFPTVDAARTMMDRIEH 361 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 32.3 bits (70), Expect = 0.32 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 370 +F YG++ ++V D R +GFA++ F + E +K + Sbjct: 40 AFSQYGQVLKVDVIMDKIRCRPKGFAYVTFSSKEEAEKAL 79 Score = 31.1 bits (67), Expect = 0.73 Identities = 15/46 (32%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEV 645 +L+V++ DK + + KGF ++TF S E+ LL+ + + G+ V Sbjct: 47 VLKVDVIMDKIRCRPKGFAYVTFSSKEEAEKALLELNAQLVDGRVV 92 >At1g72800.1 68414.m08416 nuM1-related contains similarity with nuM1 GI:1279563 from [Medicago sativa] Length = 335 Score = 32.3 bits (70), Expect = 0.32 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI 391 F ++GEI + V TG S G+A+I K E +K + G H + Sbjct: 258 FSSFGEITRVFVPPSHGTGGSLGYAYIDLK--EGAEKALELGRHDV 301 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 32.3 bits (70), Expect = 0.32 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = +2 Query: 374 AGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 508 AG H N D ++ + IFVGGL ++++++++ FS+FG Sbjct: 310 AGGHGGNGSMSD---GESNNSTIFVGGLDADVTEEDLMQPFSDFG 351 Score = 31.5 bits (68), Expect = 0.56 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 257 GAYGEIESINVKTDPNTGRSRGFAFIVF 340 G Y ++ V D NTGRS+G+ F+ F Sbjct: 235 GRYPSVKGAKVVIDSNTGRSKGYGFVRF 262 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 32.3 bits (70), Expect = 0.32 Identities = 14/51 (27%), Positives = 28/51 (54%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 406 F G++ +++ DP T SRGF FI K+ ++ + + +H++ +V Sbjct: 65 FAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRV 115 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 31.9 bits (69), Expect = 0.42 Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPK 415 +F YG + V D T RSRGF F+ + + + ++ + +N ++V K Sbjct: 22 AFSGYGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAAVSGMDGKELNGRRVSVK 77 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 31.9 bits (69), Expect = 0.42 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 361 F + G +E + V D TGRSRGF F+ ++ Sbjct: 119 FESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVE 154 Score = 31.9 bits (69), Expect = 0.42 Identities = 14/60 (23%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKAR 430 F G++ V D ++GRS+GF F+ + + + K + + ++ +++ +A+AR Sbjct: 269 FNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEAR 328 Score = 31.5 bits (68), Expect = 0.56 Identities = 14/55 (25%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKP 672 ++E + +D+ + KGF F+T S Q V + + + G+++ V A +P Sbjct: 275 VVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEARP 329 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 31.9 bits (69), Expect = 0.42 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 361 F + G +E + V D TGRSRGF F+ ++ Sbjct: 119 FESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVE 154 Score = 31.9 bits (69), Expect = 0.42 Identities = 14/60 (23%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKAR 430 F G++ V D ++GRS+GF F+ + + + K + + ++ +++ +A+AR Sbjct: 277 FNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEAR 336 Score = 31.5 bits (68), Expect = 0.56 Identities = 14/55 (25%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKP 672 ++E + +D+ + KGF F+T S Q V + + + G+++ V A +P Sbjct: 283 VVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEARP 337 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 31.9 bits (69), Expect = 0.42 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFK 343 SF + V D TGRSRGF F+ F+ Sbjct: 163 SFSVFSSCSDARVMWDQKTGRSRGFGFVSFR 193 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 31.9 bits (69), Expect = 0.42 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVF 340 F + GEI++++V D +TG S+G A++ F Sbjct: 425 FSSCGEIKNVSVPIDRDTGNSKGIAYLEF 453 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 31.5 bits (68), Expect = 0.56 Identities = 16/60 (26%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 687 ++E ++ D+ ++ KGF F+TF S ++ L++ + + G+ + V A K GG Sbjct: 60 VVEAQIVMDRVSDRSKGFGFVTFASADEAQKALMEFNGQQLNGRTIFVDYAKAKQSLGGG 119 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKA 427 +F G++ + D + RS+GF F+ F + + K +M +N + + AKA Sbjct: 53 AFSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALMEFNGQQLNGRTIFVDYAKA 112 Query: 428 R 430 + Sbjct: 113 K 113 >At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 674 Score = 31.5 bits (68), Expect = 0.56 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 373 F +GE+ + TDP TG+ G A+I F E+ + ++ Sbjct: 536 FNKFGEVLKAFIVTDPATGQPSGSAYIEFTRKEAAENALS 575 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 31.5 bits (68), Expect = 0.56 Identities = 27/106 (25%), Positives = 45/106 (42%), Gaps = 21/106 (19%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-----DPKK 418 F + + +N+ + T RG F+ E DKV+ ++ +NKK P + Sbjct: 32 FREFSIVNEVNIIKEKTTRAPRGCCFLTCPTREDADKVI----NSFHNKKTLPGASSPLQ 87 Query: 419 AKARHG----------------KIFVGGLSSEISDDEIRNFFSEFG 508 K G K+FVG L +S+ E+++ FSE+G Sbjct: 88 VKYADGELERLDVLDCSCNPEHKLFVGMLPKNVSETEVQSLFSEYG 133 >At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 501 Score = 31.1 bits (67), Expect = 0.73 Identities = 13/51 (25%), Positives = 28/51 (54%) Frame = +2 Query: 272 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAK 424 IE++ V DP+ +G A+++FK E+ + V+ G + +++ + K Sbjct: 313 IEAVRVIRDPHLNIGKGIAYVLFKTREAANLVLKKGYLKLRERELRISRVK 363 >At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing protein low similarity to splicing factor SC35 [Arabidopsis thaliana] GI:9843653; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 31.1 bits (67), Expect = 0.73 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINN 397 F +G++ + V D +T +SRG AF+++ + E K + + I N Sbjct: 77 FSTFGKVARVTVLKDRHTRQSRGVAFVLYVSREDAAKAARSMDAKILN 124 >At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing protein low similarity to heterogeneous nuclear ribonucleoprotein G [Mus musculus] GI:5579009; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 152 Score = 30.7 bits (66), Expect = 0.97 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 352 F A+GEI + + D RS+G+AFI F + + Sbjct: 60 FSAFGEIAEVKLIKDEAMKRSKGYAFIQFTSQD 92 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 30.7 bits (66), Expect = 0.97 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFGLS*KWRCPL 535 K++VGG+ + ++DEIR++F G+ K C + Sbjct: 162 KLYVGGIPYQSTEDEIRSYFRSCGVIIKVDCKM 194 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/30 (33%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +3 Query: 162 NSAXAPGRDDD-RKLFVGGLSWETTDKELR 248 +S AP D ++++G L+W+TT++++R Sbjct: 250 SSGFAPEMVDGYNRVYIGNLAWDTTERDIR 279 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 30.7 bits (66), Expect = 0.97 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFK 343 F Y V D TGRSRGF F+ F+ Sbjct: 159 FSVYPTCSDARVMWDQKTGRSRGFGFVSFR 188 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 373 +F +GE+ V TD +G S+GF F+ + E K +A Sbjct: 75 AFAQFGEVADAKVVTDRVSGYSKGFGFVRYATLEDSAKGIA 115 >At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 409 F YG+I + +D T RS+G+ F+ FK ++ + IN ++ + Sbjct: 37 FIKYGDILEAVIISDKLTRRSKGYGFVTFKDAKAATRACEDSTPIINGRRAN 88 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDH 254 K+FVGGL+W+T + + DH Sbjct: 18 KVFVGGLAWDTHKEAMYDH 36 >At3g11400.1 68416.m01390 eukaryotic translation initiation factor 3G / eIF3g nearly identical to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751 Length = 294 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 370 F +G + + V D TG SRGF F+ F + E + + Sbjct: 233 FHPFGAVTRVYVAIDQKTGVSRGFGFVNFVSREDAQRAI 271 >At2g21690.1 68415.m02580 RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 117 Score = 30.3 bits (65), Expect = 1.3 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 1/87 (1%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKAR 430 F +G + + D +TG+SR F F+ F+ +S+ D +M V+ ++K Sbjct: 27 FSKFGNVIDSKIIYDRDTGKSRRFGFVTFEEEKSMTDAIMI--------MDVEESRSKC- 77 Query: 431 HGKIFVGGLSSEISDDEIRNFFSEFGL 511 + VG ++ E++ +N +EF L Sbjct: 78 ---VNVGSITVEVARQRRKNRSAEFAL 101 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 370 F +G+I+ + D T R +GF FI F + + K + Sbjct: 27 FSPFGQIKEARLIRDSETQRPKGFGFITFDSEDDARKAL 65 Score = 27.9 bits (59), Expect = 6.8 Identities = 18/46 (39%), Positives = 23/46 (50%) Frame = +1 Query: 511 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVD 648 I E + D + KGF FITF+SE LK ++ GK VD Sbjct: 33 IKEARLIRDSETQRPKGFGFITFDSEDDARKALK----SLDGKIVD 74 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMAA 376 F +GE+ES+++ T R G AF+ FK A S+ + AA Sbjct: 581 FTVFGEVESLSLVLHKVTKRPEGTAFVKFKTADASVAAISAA 622 Score = 29.1 bits (62), Expect = 3.0 Identities = 14/61 (22%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKA 427 +F G + + T+ + RGFAF+ F E +++ + T+ +++ K+A Sbjct: 39 AFSEVGPVRRCFLVTNKGSDEHRGFAFVKFALQEDVNRAIELKNGSTVGGRRITVKQAAH 98 Query: 428 R 430 R Sbjct: 99 R 99 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 29.9 bits (64), Expect = 1.7 Identities = 26/90 (28%), Positives = 38/90 (42%), Gaps = 12/90 (13%) Frame = +2 Query: 275 ESINVKTDPNTGRSRGFAFIVFKAPE-------SIDKVMAAGEHTINNKKVDPKKAK--- 424 E + V + +TG+SRGFAF+ E ++D G N PK K Sbjct: 112 ELVEVLYNRDTGQSRGFAFVTMSNVEDCNIIIDNLDGTEYLGRALKVNFADKPKPNKEPL 171 Query: 425 --ARHGKIFVGGLSSEISDDEIRNFFSEFG 508 K+FVG LS ++ + + F E G Sbjct: 172 YPETEHKLFVGNLSWTVTSESLAGAFRECG 201 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 370 +F G++ V D +TGRSRG+ F+ + + ++ + Sbjct: 196 AFRECGDVVGARVVFDGDTGRSRGYGFVCYSSKAEMETAL 235 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 29.5 bits (63), Expect = 2.2 Identities = 25/106 (23%), Positives = 45/106 (42%), Gaps = 24/106 (22%) Frame = +2 Query: 263 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTIN---------NKK-- 403 Y ++ V D TGRS+G+ F+ F + M G++ + NKK Sbjct: 197 YSSVKGAKVVNDRTTGRSKGYGFVRFADESEQIRAMTEMNGQYCSSRPMRTGPAANKKPL 256 Query: 404 -VDPKKAKARHGK----------IFVGGLSSEISDDEIRNFFSEFG 508 + P + G IFVG + +++D++++ F +FG Sbjct: 257 TMQPASYQNTQGNSGESDPTNTTIFVGAVDQSVTEDDLKSVFGQFG 302 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVF 340 F +YG I+ +++ TD T + +G+AFI + Sbjct: 158 FESYGPIKRVHLVTDQLTNKPKGYAFIEY 186 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 78 NDNFAQDITTDNQLNGNAENGGGDSQDHNSAXAPGRDDDR 197 NDN + +N N N NGGG ++ S P R+ DR Sbjct: 119 NDNNGNNNNGNNNDNNNQNNGGG--SNNRSPPPPSRNSDR 156 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 75 NNDNFAQDITTDNQLNGNAENGGGDSQDHNS 167 NN N D +N N N +N G+++D+N+ Sbjct: 76 NNGNNNNDNNNNNNGNNNNDNNNGNNKDNNN 106 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 437 KIFVGGLSSEISDDEIRNFFSEFG 508 KIFVG L+ + D++R +F +FG Sbjct: 13 KIFVGNLTWRTTADDLRRYFEQFG 36 Score = 29.1 bits (62), Expect = 3.0 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDHLE 260 K+FVG L+W TT +LR + E Sbjct: 13 KIFVGNLTWRTTADDLRRYFE 33 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/63 (23%), Positives = 29/63 (46%) Frame = +2 Query: 320 GFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFS 499 G I + I V+ + + ++ P + K++V GLS ++D +R+ F Sbjct: 39 GTGVISARRRRDIGGVLISSCLSTDSSSSPPSSSSGPKTKLYVSGLSFRTTEDTLRDTFE 98 Query: 500 EFG 508 +FG Sbjct: 99 QFG 101 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 198 KLFVGGLSWETTDKELRDHLE 260 KL+V GLS+ TT+ LRD E Sbjct: 78 KLYVSGLSFRTTEDTLRDTFE 98 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 29.5 bits (63), Expect = 2.2 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = +1 Query: 535 DKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKE--VDVKRAT 663 D T + KGF F FES E ++ + +RTI G+E V+V +AT Sbjct: 237 DPTTKKPKGFGFYEFESAEGILRAIRLLTQRTIDGQELLVNVNQAT 282 >At3g63450.1 68416.m07144 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 399 Score = 29.1 bits (62), Expect = 3.0 Identities = 16/64 (25%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPKKAKAR 430 F +G ++ + + + R F F+ F PE++ ++A G H + + +V K K + Sbjct: 176 FSTFGPVQDVRIPYQ----QKRMFGFVTFMYPETVKSILAKGNPHFVCHSRVLVKPYKEK 231 Query: 431 HGKI 442 GK+ Sbjct: 232 -GKV 234 >At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, EMBL:D86122 Length = 915 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +2 Query: 377 GEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 508 GE NN + + + + VG +SS + D E++ F +FG Sbjct: 198 GERGGNNSVGELNRGEIPSRTLLVGNISSNVEDYELKVLFEQFG 241 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 370 F +G + +V D T SRGF F+ F + E + + Sbjct: 194 FRPFGAVTRCHVAIDQKTSMSRGFGFVSFVSREDAQRAI 232 >At3g51950.1 68416.m05698 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM), PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 540 Score = 28.7 bits (61), Expect = 3.9 Identities = 16/64 (25%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPKKAKAR 430 F +G ++ + + + R F F+ F PE++ ++A G H + + +V K K + Sbjct: 279 FSTFGPVQDVRIPYQ----QKRMFGFVTFVYPETVKSILAKGNPHFVCDSRVLVKPYKEK 334 Query: 431 HGKI 442 GK+ Sbjct: 335 -GKV 337 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 147 DSQDHNSAXAPGRDDDRKLFVGGLSWETTDKELRDHLE 260 DS+D + + +P +KLF+ GLS+ T++K LR E Sbjct: 267 DSRDQDDSESPPVKT-KKLFITGLSFYTSEKTLRAAFE 303 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +2 Query: 251 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 355 +F +GE+ + + D + RS+G+AF+ + E+ Sbjct: 301 AFEGFGELVEVKIIMDKISKRSKGYAFLEYTTEEA 335 >At2g47390.1 68415.m05915 expressed protein Length = 961 Score = 28.7 bits (61), Expect = 3.9 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +3 Query: 120 NGNAENGGGDSQDHNSAXAPGRDDDRKLFVGGLSWETTDKELRD 251 +G AE+GGG S SA A +DD G + E+RD Sbjct: 78 SGGAEDGGGTSNGSLSASATATEDDELAI--GTGYRLPPPEIRD 119 >At2g39260.1 68415.m04821 MIF4G domain-containing protein similar to hUPF2 [Homo sapiens] GI:12232320; contains Pfam profile PF02854: MIF4G domain Length = 1186 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = +3 Query: 120 NGNAENGG--GDSQDHNSAXAPGRDDDR 197 +GN E G GD D++ PG DDD+ Sbjct: 962 DGNHERGSESGDGDDYDDGDGPGSDDDK 989 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +3 Query: 105 TDNQLNGNAENGGGDSQDHNSAXAPGRDDDRKLFVGGLSWETTDKELRDHL 257 T NG GGG + + P R + ++ V GL + ++L+DH+ Sbjct: 90 TRGSFNGGGR-GGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDHM 139 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +3 Query: 105 TDNQLNGNAENGGGDSQDHNSAXAPGRDDDRKLFVGGLSWETTDKELRDHL 257 T NG GGG + + P R + ++ V GL + ++L+DH+ Sbjct: 90 TRGSFNGGGR-GGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDHM 139 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +3 Query: 105 TDNQLNGNAENGGGDSQDHNSAXAPGRDDDRKLFVGGLSWETTDKELRDHL 257 T NG GGG + + P R + ++ V GL + ++L+DH+ Sbjct: 90 TRGSFNGGGR-GGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDHM 139 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 28.3 bits (60), Expect = 5.2 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +1 Query: 535 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRA 660 D+ + KGF FITFESE LK + + G+ + V+ A Sbjct: 100 DQQTQRPKGFGFITFESEDDAQKALKALNGKIVNGRLIFVETA 142 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = +2 Query: 251 SFGAYGEIESI----NVKTDPNTGRSRGFAFIVFK 343 SF A+ S V D TGRSRGF F+ F+ Sbjct: 167 SFSAFNSCSSYYRDARVMWDQKTGRSRGFGFVSFR 201 >At5g12440.1 68418.m01462 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 552 Score = 27.9 bits (59), Expect = 6.8 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPKKAKAR 430 F +G ++ + + + R F F+ F PE++ V+A G H I + +V K K + Sbjct: 280 FSLFGTVQDVRIPYQ----QKRMFGFVSFAHPETVKVVLARGNPHFICDSRVLVKPYKEK 335 Query: 431 HGKI 442 GK+ Sbjct: 336 -GKV 338 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +2 Query: 260 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 376 ++G ++ ++ D TG S+G+AF V++ D AA Sbjct: 381 SFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +2 Query: 260 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 376 ++G ++ ++ D TG S+G+AF V++ D AA Sbjct: 381 SFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +2 Query: 260 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 376 ++G ++ ++ D TG S+G+AF V++ D AA Sbjct: 381 SFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419 >At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing protein Length = 90 Score = 27.9 bits (59), Expect = 6.8 Identities = 9/22 (40%), Positives = 17/22 (77%) Frame = +2 Query: 443 FVGGLSSEISDDEIRNFFSEFG 508 +VG L S+ +++++N FS+FG Sbjct: 11 YVGNLESDTEENDLKNAFSQFG 32 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/58 (25%), Positives = 27/58 (46%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKA 427 FG +GE+ + + D RG ++ FKA +K + ++ ++D K KA Sbjct: 118 FGNFGEVIHVEIAMDRAVNLPRGHGYVEFKARADAEK----AQLYMDGAQIDGKVVKA 171 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/58 (25%), Positives = 27/58 (46%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKA 427 FG +GE+ + + D RG ++ FKA +K + ++ ++D K KA Sbjct: 118 FGNFGEVIHVEIAMDRAVNLPRGHGYVEFKARADAEK----AQLYMDGAQIDGKVVKA 171 >At5g44200.1 68418.m05408 nuclear cap-binding protein, putative similar to SP|P52298 20 kDa nuclear cap binding protein (CBP20) (NCBP interacting protein 1) {Homo sapiens}; non-consensus AT donor splice site at exon 4, AC acceptor splice site at exon 5; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 257 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 361 F GEI+ I + D NT GF F++F + E + Sbjct: 54 FSRAGEIKKIIMGLDKNTKTPCGFCFVLFYSREDTE 89 >At5g22830.1 68418.m02669 magnesium transporter CorA-like family protein weak similarity to SP|Q01926 RNA splicing protein MRS2, mitochondrial precursor {Saccharomyces cerevisiae}; contains Pfam profile PF01544: CorA-like Mg2+ transporter protein; supporting cDNA gi|12007446|gb|AF322255.1|AF322255 Length = 459 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 72 ANNDNFAQDITTDNQ-LNGNAENGGGDSQDHNSAXAPGRDDDRKL 203 A + A+D D + LN + ++ G DS + GRDD +K+ Sbjct: 65 AKSPTTAEDFVGDYESLNVSDDDDGSDSNSSDGDNGGGRDDSKKI 109 >At5g19030.3 68418.m02263 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 130 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 440 IFVGGLSSEISDDEIRNFFSEFG 508 +FV G S +S+ ++ FSEFG Sbjct: 60 LFVKGFSDSVSEGRLKKVFSEFG 82 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 440 IFVGGLSSEISDDEIRNFFSEFG 508 +FV G S +S+ ++ FSEFG Sbjct: 60 LFVKGFSDSVSEGRLKKVFSEFG 82 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 440 IFVGGLSSEISDDEIRNFFSEFG 508 +FV G S +S+ ++ FSEFG Sbjct: 79 LFVKGFSDSVSEGRLKKVFSEFG 101 >At5g03580.1 68418.m00316 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein [Triticum aestivum] GI:1737492; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 101 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 308 GRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 406 G SRGFAFI F++ +S + M + + +K+ Sbjct: 54 GESRGFAFIEFESADSAGRAMLHMDGRLIGQKI 86 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVF 340 F +G + + + D +G+ RGFAF+ F Sbjct: 67 FERFGPVRDVYIPRDYYSGQPRGFAFVEF 95 >At2g42890.2 68415.m05312 RNA recognition motif (RRM)-containing protein Length = 830 Score = 27.5 bits (58), Expect = 9.0 Identities = 25/88 (28%), Positives = 40/88 (45%), Gaps = 3/88 (3%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 433 FGAYGEI I + PN R + + E+ K + E I K + K +R Sbjct: 290 FGAYGEIREI--RETPNRRFHRFIEYYDVRDAETALKALNRSE--IGGKCI--KLELSRP 343 Query: 434 G---KIFVGGLSSEISDDEIRNFFSEFG 508 G ++ V S ++ E+ NF+++ G Sbjct: 344 GGARRLSVPSQSQDLERTEVTNFYNQVG 371 >At2g42890.1 68415.m05311 RNA recognition motif (RRM)-containing protein Length = 843 Score = 27.5 bits (58), Expect = 9.0 Identities = 25/88 (28%), Positives = 40/88 (45%), Gaps = 3/88 (3%) Frame = +2 Query: 254 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 433 FGAYGEI I + PN R + + E+ K + E I K + K +R Sbjct: 303 FGAYGEIREI--RETPNRRFHRFIEYYDVRDAETALKALNRSE--IGGKCI--KLELSRP 356 Query: 434 G---KIFVGGLSSEISDDEIRNFFSEFG 508 G ++ V S ++ E+ NF+++ G Sbjct: 357 GGARRLSVPSQSQDLERTEVTNFYNQVG 384 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 407 DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 508 DP + G +FV L I + ++ + FS FG Sbjct: 22 DPSNRMSGRGNVFVKNLDESIDNKQLCDMFSAFG 55 >At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30) nearly identical to SF2/ASF-like splicing modulator Srp30 [Arabidopsis thaliana] GI:4775270 Length = 268 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +3 Query: 150 SQDHNSAXAPGRDDDRKLFVGGLSWETTDKELRDHL 257 S ++++ AP R D ++ V GL + ++L+DH+ Sbjct: 94 SSSYSASRAPSRRSDYRVLVTGLPPSASWQDLKDHM 129 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,768,164 Number of Sequences: 28952 Number of extensions: 334415 Number of successful extensions: 1617 Number of sequences better than 10.0: 168 Number of HSP's better than 10.0 without gapping: 1150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1596 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -