BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20091 (706 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0515 + 23582105-23583519,23583613-23583741,23583835-235839... 28 6.3 06_01_0874 - 6702059-6702733,6703146-6703521,6703677-6703770,670... 28 8.3 >02_04_0515 + 23582105-23583519,23583613-23583741,23583835-23583970, 23584051-23584139,23584236-23584347,23584427-23584533, 23584630-23584723 Length = 693 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +3 Query: 312 LPHGRIFFP--PSLSSCRRKLVEDLKSRTPIEEKKKKVAG 425 LP + F P P+L+ R+ + +KS P+EE++ K G Sbjct: 645 LPRSKDFMPTFPALNEQDRRFKKHMKSPDPLEEQRMKEQG 684 >06_01_0874 - 6702059-6702733,6703146-6703521,6703677-6703770, 6705455-6705833 Length = 507 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 583 WLRPLRIETSFGWSPVCGMLC 521 WL + + TSFG+S +C LC Sbjct: 212 WLSVIAVATSFGYSSICLGLC 232 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,823,183 Number of Sequences: 37544 Number of extensions: 410795 Number of successful extensions: 956 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 933 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 956 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -