BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20087 (612 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 26 1.1 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 26 1.1 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 5.9 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 25.8 bits (54), Expect = 1.1 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = -3 Query: 160 RRNMSNLLHCHCCPRSWCRCSKTSWTSLTNSKTTTYHHPK 41 R + N H +W S++ TS+ + TTT HPK Sbjct: 476 RTALGNRDEPHSSSGNWSASSESGRTSIGSEITTTNTHPK 515 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 25.8 bits (54), Expect = 1.1 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = -3 Query: 160 RRNMSNLLHCHCCPRSWCRCSKTSWTSLTNSKTTTYHHPK 41 R + N H +W S++ TS+ + TTT HPK Sbjct: 477 RTALGNRDEPHSSSGNWSASSESGRTSIGSEITTTNTHPK 516 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.4 bits (48), Expect = 5.9 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = -3 Query: 133 CHCCPRSWCRCSKT 92 CHCC C C T Sbjct: 780 CHCCEFDACDCEMT 793 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 538,879 Number of Sequences: 2352 Number of extensions: 9784 Number of successful extensions: 20 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59711994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -