BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20086 (679 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974172-1|ABJ52812.1| 409|Anopheles gambiae serpin 13 protein. 27 0.54 AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsiv... 25 2.2 >DQ974172-1|ABJ52812.1| 409|Anopheles gambiae serpin 13 protein. Length = 409 Score = 27.1 bits (57), Expect = 0.54 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -3 Query: 461 LLSSETSNNPLVDLLR--AFAMTSVSSVSLARRLNFVRISNGPIRHLIL 321 L S TSN L ++L+ +FAM + AR L F S ++H +L Sbjct: 295 LQDSSTSNLYLSEILQTDSFAMCGGGELGAARNLPFRSFSTNLVKHSVL 343 >AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsive protein 1 protein. Length = 447 Score = 25.0 bits (52), Expect = 2.2 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +2 Query: 293 HRDKFLQEQIKLDDGWVH*KFSQNSIALPN*QRTQMSSQMPLTNLRVDY 439 HR++F L + +VH KF LP+ +T + +PL +DY Sbjct: 200 HREEFTALVRDLKNAFVHDKFQLGYTQLPHVNQT-IFLDIPLLKDNIDY 247 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 644,592 Number of Sequences: 2352 Number of extensions: 12711 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -