BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20086 (679 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 23 3.5 AF134817-1|AAD40233.1| 105|Apis mellifera FABP-like protein pro... 23 3.5 AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding pr... 23 3.5 DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. 22 6.2 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 8.2 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 8.2 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 Query: 162 EDKEVTVETNGQEENAKTENSEDE 233 E + +V T +EN KTE DE Sbjct: 301 EISQNSVSTGSDKENHKTEEPNDE 324 >AF134817-1|AAD40233.1| 105|Apis mellifera FABP-like protein protein. Length = 105 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 144 FNGKYLLISENKFIEASKL 88 F GK+ +S+N F E +K+ Sbjct: 2 FEGKFQFVSQNNFEEFAKV 20 >AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding protein protein. Length = 135 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 144 FNGKYLLISENKFIEASKL 88 F GK+ +S+N F E +K+ Sbjct: 4 FEGKFQFVSQNNFEEFAKV 22 >DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. Length = 132 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +2 Query: 248 CDFRQVEYYFGDVNLHRDKFLQEQIKLDDGWVH 346 C ++V + D + +KF + KLD V+ Sbjct: 65 CMLKKVGFVNADTTFNEEKFRERTTKLDSEQVN 97 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 8.2 Identities = 11/40 (27%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +3 Query: 537 IYAKGFAKDASLDDLLNYFKQFQ-EVENVIMRRYVRNPQR 653 IY + ++D L+ YF+QF + N ++ RN + Sbjct: 445 IYPNLKIESFTVDKLITYFEQFDTTINNGLLLEEQRNDDK 484 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 8.2 Identities = 11/40 (27%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +3 Query: 537 IYAKGFAKDASLDDLLNYFKQFQ-EVENVIMRRYVRNPQR 653 IY + ++D L+ YF+QF + N ++ RN + Sbjct: 445 IYPNLKIESFTVDKLITYFEQFDTTINNGLLLEEQRNDDK 484 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,304 Number of Sequences: 438 Number of extensions: 3212 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -